SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012874 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012874
Domain Number 1 Region: 466-757
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.71e-46
Family Eukaryotic proteases 0.0000107
Further Details:      
 
Domain Number 2 Region: 193-461
Classification Level Classification E-value
Superfamily vWA-like 1.91e-33
Family Integrin A (or I) domain 0.0000572
Further Details:      
 
Domain Number 3 Region: 88-149
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000005
Family Complement control module/SCR domain 0.00061
Further Details:      
 
Domain Number 4 Region: 155-211
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000625
Family Complement control module/SCR domain 0.00063
Further Details:      
 
Domain Number 5 Region: 36-98
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000122
Family Complement control module/SCR domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012874   Gene: ENSTNIG00000009980   Transcript: ENSTNIT00000013066
Sequence length 769
Comment pep:known_by_projection chromosome:TETRAODON8:7:4387057:4391622:-1 gene:ENSTNIG00000009980 transcript:ENSTNIT00000013066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRMPICWSCTAALFYVMCLGPVWSDCPEQDVAIVGGHYKLTRDLQPGSMLIYYCPEGYYP
YPYLTRVCQPNGTWKSARVSRRALPQRCRLVECPDPNVLISGNVSPPQEKYYVDNETTYE
CDSGYTLRGSSRRICLPNGKWSGSTPICSRDTGDHCADPGIPAGAMRSGNIFGIDDKVKY
SCIDKLFLMGSSERKCLESGQWTGNEPACYFKHTYDTPLEVSQAFGSAIKESLTTLESIN
DVQGERKIRISKNGTLNIYIAVDISESIQKDHVESAKKAILKLITKISSFSVSPNYELLF
FSSELSEVVNILDFFENQPVDIKGRLTKFKVNAEEHTGTDLNLAFKTILVRMALIKQRVG
EKAFEEHRHAIIVFTDGVYNMGGSPLPTVAKIKHMVYMNKIDEETGQNPRDEYLDIYIFG
IGAEIYESDLRPLTAGTGGEHFFKLMEIQNLQETFDNIIDEEEVVGLCGLHKDYDTGLAD
STRNMFPWKAAITVQGKLKREGNTKYCLGSLVSPQFILTAAHCFTFDDESKHVTVEIDDG
NGKYKKVKTFKLHPNYNINAKADEGVKEFYDYDVALIQLMEDVQISPSVRPICIPCTQET
SNALGLVGNSTCKQQGPEEKLLATQLEKLFFLTSKGSITQKKEAHAKLGDNRDECIRYAL
DAEGIKTTNPKIPVTDNFICTGGQTPFRDHIACTGDSGGAVFKNYEHRTVQVALVSWGTK
SLCKSGELKESVKNSRDFHLNLFKVIPFLKNILGNNTQDEYAPLQFLRT
Download sequence
Identical sequences H3CX89
99883.ENSTNIP00000012874 ENSTNIP00000012874 ENSTNIP00000012874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]