SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012896 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012896
Domain Number 1 Region: 57-174,205-253
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.64e-25
Family Laminin G-like module 0.000000394
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012896   Gene: ENSTNIG00000010001   Transcript: ENSTNIT00000013088
Sequence length 450
Comment pep:known_by_projection chromosome:TETRAODON8:7:4543151:4563124:-1 gene:ENSTNIG00000010001 transcript:ENSTNIT00000013088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLAFWFALLTALPIQTGTARVSSSLSTTHHVHHFHNKHGTVPIAINRMPFLTRGGHAGTT
YIFGKGGALITFTWAPNERPSTRADRLAVGFSSQQKDAILVRVESTHGLGDYLQLHIDQG
KIGVIFNVGTDDITIDEPAVIVNDGKYHVVRFTRSGGNATLQVDNHPVIERYPPGHYDNE
RLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQAAIKIGGSDKARPFQGQISGLYYNGL
QVLKLAAENDPSVQVEGNLRLVGDSFSVLTTDTTSATPLAVSDMSTTIMETTTTMATTTT
RRQRSPSLRESISKPQSSDDSLVASAECPSDDEDLEECEHGTGGSANPTASDEKSLPGAV
EVIRESSSTTGMVVGIVAAAALCILILPYAMNKHRNRDEGSYQTETEPHFCNSSTLEGNG
TVIKDKSTASSSVAKAVTKGKKNKDKEYYV
Download sequence
Identical sequences H3CXB1
ENSTNIP00000012896 ENSTNIP00000012896 99883.ENSTNIP00000012896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]