SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012899 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012899
Domain Number 1 Region: 158-251
Classification Level Classification E-value
Superfamily Immunoglobulin 1.23e-22
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 262-303
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000415
Family EGF-type module 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012899   Gene: ENSTNIG00000010004   Transcript: ENSTNIT00000013091
Sequence length 727
Comment pep:known_by_projection chromosome:TETRAODON8:7:4645137:4700999:-1 gene:ENSTNIG00000010004 transcript:ENSTNIT00000013091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PQPTEPCRSAPSDHRAKAGGMRLDSVHLSMLLIGVSFACYSPTLNSLQEQAYKSAVVIEG
KVQSTPGNVSAEPHRVNVKVLDVWPLHSGGLEREQLVTVGELGSEAPCTKVKRNHKYIFF
MDPTDEPLLFKASFAPLETSGKNVKKDVGRILCEDCAAAPKLKPMLIPTRVEEGNKLIVK
CEATGNPLPTYRWFKDGNELKKSKKVRIRNSQKNSRVQINKARVEDSGNYTCVVENLLGK
DNSTGTVQVQSMTTTLATGSGHARKCNETEKAYCVNGGDCYFIHGIDRLSCKCQDGYFGP
RCLQTEPLRLYMPNPFKKAEELYQKRVLTVTGICVALLVVGIVCVVAYCKTKRQRNRMHN
HLRQNLFPEPPNRNLANGPNHPGPGPEEIPMVDYISKIMPATERVIRPVTEESFPASHAS
SRSHNSSTRAHSSTHRHEERTWSLEHSDSILSDSAGMMSSSVGTSKCSSPACVEARARRA
AHCGYSDSHQPGLQYGDSFDSLGDSPHSDRYVSALTTPARLSPVEFHYSLPAQVPTFQIT
SPNASHAMSLPPAVHNPYPLEDNQPLLRRYHVPLHDAQYQEPYRQQRRTYLNDSRGSLPA
SPYRLAEEEDYETTQENLSSREQPKRSGSSGNRGRRWRRSRLNGHVAPRGYEVSRDYGSR
SCLTESESDEDGESTPFLSMQNMNAEPSTIYRPVDSRTSHSSGRHSGNSDMHTRLSHSRS
KPDNTPH
Download sequence
Identical sequences H3CXB4
ENSTNIP00000012899 ENSTNIP00000012899 99883.ENSTNIP00000012899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]