SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012906 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012906
Domain Number 1 Region: 234-377
Classification Level Classification E-value
Superfamily MIR domain 8.63e-38
Family MIR domain 0.0057
Further Details:      
 
Domain Number 2 Region: 3970-4048
Classification Level Classification E-value
Superfamily EF-hand 0.000000752
Family Calmodulin-like 0.05
Further Details:      
 
Domain Number 3 Region: 405-535
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.000000759
Family IP3 receptor type 1 binding core, domain 2 0.011
Further Details:      
 
Domain Number 4 Region: 645-779
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000135
Family SPRY domain 0.065
Further Details:      
 
Domain Number 5 Region: 103-185
Classification Level Classification E-value
Superfamily MIR domain 0.00000379
Family MIR domain 0.023
Further Details:      
 
Domain Number 6 Region: 1342-1467
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000454
Family SPRY domain 0.026
Further Details:      
 
Domain Number 7 Region: 2077-2147
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000497
Family IP3 receptor type 1 binding core, domain 2 0.014
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000012906
Domain Number - Region: 1065-1112
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00232
Family SPRY domain 0.044
Further Details:      
 
Domain Number - Region: 538-612,1919-2161,2486-2526,2563-2597,2830-2888,2996-3041,3125-3182
Classification Level Classification E-value
Superfamily ARM repeat 0.0207
Family PBS lyase HEAT-like repeat 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012906   Gene: ENSTNIG00000010011   Transcript: ENSTNIT00000013098
Sequence length 4875
Comment pep:known_by_projection chromosome:TETRAODON8:7:4800418:4835608:1 gene:ENSTNIG00000010011 transcript:ENSTNIT00000013098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGADGEEEIQFLRTVSDATMWCSQCTASILKEQIKVCLSCEGFGNRLCFLETTSNAQN
VPPDLAICCFILEQSLSVRALQEMLSNTSLDESSQGGGHRTLLYGHAILLRHIHSSMYLS
CLTTSRSLTDKLAFDVGLQEDSTGEACWWTIHPASKQRSEGEKVRVGDDLILVSVSSERY
LHLSYASGDLMVDASFMQTLWTMTPVMSGCELAEGFLSGGYEPTKGTTSAGFGINGGAVC
SHARSLWRLEPLRIGWSGSHIKWGQSFRIRHITTGRYLFLDEDKGLLLVDAEKANSKMSA
FCFRISKEKIEVAQKRDVEGMGTPEIKYGESMCFVQHVSSGLWLTYAAVDAKSARLGPLK
RKAILHKEGHMDDALTVARSQTEESQAARMIYSTTGLFNQFIKGLDALSGKNKSANPSSL
PMDTVVLSLQDLIFYFRPPEEELEHEEKQFKLRSLKNRQNLFQEEGMISLVLDCVDRLNV
YNTAAHFSEYAGEEAAESWKEIVNLLYELLASLIRGNRANCALFCDNLDWLVSKLDRLEA
SSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKVLDVLCSLCVCNGVAVRS
NQNLITENLLPGRDLLLQTNIINYATSMRPNIFLGTCEGSTQYKKWYFEVMVDHVEPFLT
AQPYHLRVGWALTEGYSPYPGGGEGWGGNGVGDDLYSYGFDGLHLWSGRVPRHVASPNQH
VLTAEDVVSCCLDLSVPSISFRINGHPVQGMFENFNLDGLFFPVVSFSAGVTFRFLLGGR
HGDFKFLPPPGYAPCYEAVLPRDRLRIEPIKEYKHDFDGVRNLLGPTQSLSHTAFTPCPV
DTIQIVLPPHLERIREKLAENSHELWAVTRIEQGWTYGPFRDDNKKLHPCLVDFQSLPEP
EKNYNLAMSGETLKTLLALGCHVGMGDEKAEENLKRIKLPKTYMQTSGYKPAPLDLNHVK
LTPNQNTLVERLAENGHNVWARDRVRQGWTYSIVQDIVNRRNPRLVPYNLLDEKTKKTNR
DTVCSAVRTLIGYGYNIEPPDQESSADGPGSPRGDKIRVFRAEKSYAITQGKWYFEFEAV
TVGEMRVGWARPSVRADTELGADELAYVFNGFKAGPKSRYMPVKIPQSAIQSAVIPVCSL
GLSQVGRINLGQNVSSLRYFTICGLQEGFEPFAINMKRDITMWFSKSLPQFINAPTDHPH
VEVARVDGTVETPPCLKVTHKTFGSQNANTDLLFFRLSMPIEFHETFKVPAGTTLLTRAL
TIPEEESATRKEQEEEKKEPSVPKEIPAAKNGENEKDASTEKSKKKGFLFKAKKAALINP
PPVVPTMPRLVEDVVPDDRDDYYYSVRVFAGQEPSGIWVGWITPDYHQYDPHFDINKIRN
VTVTVGDDKGNIHDSIKRSNCYMVWGGEFSNSQQTRVSQEDFIIGCLVDLDTGLMTFTAN
GKEINTFYQVEPNTKLFPAVFVLPSSQNMIQFELGKLKNIMPISAAMFRSERKNTVPQCP
PRLDVQMLTPVIWSRMPNHFLAPETGRASERLGWIVQCHEPLTMMALHIPEENRCIDILE
LSERMDLLKFHYHTLKLYGSVCALGNNRVAHALCSHVDESQLFYAIQNTYLPGPIRSGFY
DLLISMHLESAKRGRLGTNREFIIPMTDETRSITLYTDKSCALPGVGLTTCLRPKLHFSS
VGFVGTNQDIYTLSPVIPLQILKTKALNMLTEAVQDGVQAMRDPVGGSVEFHFVPILKLI
STLLIMGVFDDEDVTHILKMLEPTVFSGKKEEEPAEDNADAIKQKEQETPQQAATTSGES
EESLEEGLFQMKLPESVKLQMCTLLQYFCDCELRHRVEAIIAFSDMFVSQIQSNQRQRYN
ELMLAFTMSAAETARKTREFRSPPQEQVNMLMNFKNCAEDEDCPIPDEVRESMLIFHNAL
LAHCGVHIEEEEVEEEVDNSLRGRLVRLLEKVKKFREKKVEMELEPQEDKKPSTLQELIS
HTTIHWAQESFIQNPELVRMMFSLLHRQYDGLGELIRALPKAYTINAVSITDTMDLLECL
GQIRSLLIVQMGPEEERLMIQSIGNIMSNKVFYQHPNLMRALGMHETVMEVMVNVLGGGD
SKEIRFPRVVTNCCRFLCYFCRISRQNQRSMFDHLSYLLQNSGIGLGMRGSTPLDVAAAS
CIDNNELALALQEQDLEMVVKYLAGCGLQSCPMLLAKGYPDIGWNPCGGEKYLDFLRFAV
FVNGESVEENANVVVRLLIRRPECFGPALRGEGGNGLLAAIEEAIKISEDPARDGPSTKK
DRRLEERNSMRRTGCTWGNAIMSFYSALIDLLGRCAPEMHLIQAGKGEALRIRAILRSLV
PIEDLVGVISLPVQIPSFGKDNSIIEPKMSASFVPDHKAPMVLFLDRVYGIDNQDFLLHV
LEVGFLPDMRAAASLDTAAFSTTEMALALNRYLCSAVLPLITKCAPLFAGSDHRAIMIDS
MLHTIYRLSRGRAFTKAQRDIIEECLMALCKHLRPSMLQHLLRRLVFDVPILNEYAKMPL
KLLTNHYERCWKYYCLPNGWASFGVASEEELHLTRKLFWGIFESLAHKKFDAEIFKISMP
CLCAIAGAIPPDYVDASYSSKTEKKASVDAEGNFDPKPVDTTNTIIPERLDAFINRYAEY
THDKWAFEKIQNNWSYGETLDENAKTHPMLRPYKTFSEKDKEIYRWPIKESIKAMIAWDW
MNIPPHPYNISYILLNTLDIFFSPRQPMIQAMATAHSPSISHIWLSPETCSLWQNNWQKI
TITPGDGRKSWSCSPKYIDRMKDSVLTLFLQLNGYAVTRGLKDMESDISSIEKRFAYGFL
QKLLKWMEIAQEFIAHLEAVVSSGRVEKSPHEQEIKFFAKILMPLINQYFKNHCLYFLST
PAKVLGSGGHSSNKEKEMIASIFCKMSALVRHRVSLFGTDASAIVNCLHILARSLDARTV
MKSGPEIVKAGLRSFFESAADDIEKMVENLKLGKVSKGNQQVKGVSQNINYTTIALLPVL
TSLFDHIAQHLFGDDVILDDLQMSCYRIMCSIYSLGTVKNPHVERQRPALGECLAHLAAA
MPVAYLEPHLNEFNAFSVYTTKTPRERAILGLPNEVQELCPDIPELDVLLKEIGDLAESG
ARYTEMPHVIEITLPMLCNYLPRWWERGPENFPEMEGKVCTDVTSEHLNQLLGSIMKIVV
NNLGIDEASWMKRLAVFSQPIVSRAKPEMLKSHFIPTMEKLKKRTSKVVAEEDHLRMEGK
TEADEEDGTIRDEFAVLCRDLYALYPLLIRYIDNNRARWLTCPDPDAEELFRMVGEVFIF
WSKSHNFKREEQNFVVMNEINNMSFLTADSKSKMSKGGGSDTERTKKKKRGDRYSVQTSL
IVAALKKMLPIGLNMCSPADQELINLAKIRYSLRDTDEEVREFLQNNLHLQGKVDNPSMR
WQMALYKEMAGKAEDADAPVKVVKRVQEVSAVLYHLEVTEHPFKSKKMVWHKLLSKQRRR
AVVACFRMTPLYNIPRHRASNMFLEGYKRNWLYTEGYAFEDRMIDDLSVSLISRLCLLKD
PDPLHQLILHFSRTALTEKSKLDTDHLYMAYADIMAKSCHIDEEEEGGEEMVENDEDEKS
FESELVMGGQGLGTRNTLERVRLITSAHAYTRTHMLTEFKGCTANFNNTAGRALFDLQEK
EMEKQRLLYQQSRLHNRGAAEMVLQMISACKGETGPMVTTTLKLGISILNGGNSEVQRKM
LEYLRDKKDVGFFLSVQALMQTCSVLDLNAFERQNKAEGLGMVSEEGTSEKVMADDEFTC
DLFRFLQLLCEGHNNDFQNYLRTQIAVTKKQSLTFHTRPMHIKRCESISDFYWYYSGKDV
IDEPGKKNFSKAMTVAKQIFNTLTEYIQGPCTGNQQSLAHSRLWDAIVGFLHVFAHMMMK
LAQRITRLDGDISKEDLEEKKHNFECVLLISSFYSELELKHISADSSKRNVVNGTIARQM
VDMLVESSSNVEMIVKFFDMFLKLKDIVASDAFRDYVTDPRGLISKKDFQKAMDSQKQYS
PSEIQFLLSCSEADENDMIHYEEFASRFQEPAKDIGFNIAVLLTNLSEHVPHDTRLQNFL
EQAESVLNYFRPFLGRIEIMGASRKIERIYFEISEVNRRQWEMPQVRESKRQFIFDVVNE
GGESEKMEMFVNFWGDEEGNGEEGQPESSSAFAEFINSTISFFSIFTFRNLRRQYRRVRK
MTIKEIIVALSTFFWAILMSILHFIYSVCKGFFMIIWQALFGGGLVEGAKNITVTEILAS
MPDPTQDDTGSGEEEEEDTQEKEGGRIPGIDAPGGLGDMGVESPVEPPTPEGTPITKRKM
VCKKVRPHHSLLTSSKSITRLPCANDFDVESGEKAEKDPQSLEEKLEKPKKSAQKKEKKV
KGEEGFQIWSELETQRSKFLNYLSRNFYNLRFLALFLAFALNFILLFYRVSDTPPEGEEL
EGSGLSEGSGIFEASGLSRSSGLKENDEDMPIYFYLEESTGYMQPTLAFLAALHTVISFI
CIIGYNCLKIPLVIFKREKELARKLEFDGLYITEQPEEDDIKGQWDRLVLNTPSFPNNYW
DKFVKTKVLDKYGDIYGRERIAELLGVDLASLDWALTKFKSFFFFIYRITSIDMKYQIWK
FGVVFTDGTFLYLCWYMIMSLLGHYNNFFFACHLLDIAMGVKTLRTILSSVTHNGKQLMM
TVGLLAVVVYLYTVVAFNFFRKFYNKSEDEDEPDMKCDDMMTCYLFHMYVGVRAGGGIGD
EIEDPAGDEYELVKHGGWDAVLNFPETSKMPALLSVGLIIDAFGELRDQQEQVKEDMETK
CFICGIGSDYFDTTPHGFETHTFDEHNLANYMFFLMYLINKDETEHTGQESYVWKMYQER
CWDFYPCWRLFQKAI
Download sequence
Identical sequences H3CXC1
ENSTNIP00000012906 ENSTNIP00000012906 99883.ENSTNIP00000012906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]