SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012963 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012963
Domain Number 1 Region: 797-1078
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-66
Family Protein kinases, catalytic subunit 0.0000121
Further Details:      
 
Domain Number 2 Region: 483-771
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.54e-45
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Domain Number 3 Region: 371-472,508-533
Classification Level Classification E-value
Superfamily SH2 domain 2.83e-21
Family SH2 domain 0.002
Further Details:      
 
Domain Number 4 Region: 260-358
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000295
Family Third domain of FERM 0.016
Further Details:      
 
Domain Number 5 Region: 123-230
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000188
Family Second domain of FERM 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012963   Gene: ENSTNIG00000010067   Transcript: ENSTNIT00000013155
Sequence length 1098
Comment pep:known_by_projection chromosome:TETRAODON8:1:19164092:19169848:1 gene:ENSTNIG00000010067 transcript:ENSTNIT00000013155 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVIRDRGGSQTSSSSAGGSLQVHLYFVPATKKATTIHMTSGQISAENVCIQAGKKSGILP
VYIGLFGLASADLSFWYPPSHMFNTEENLHVCFRVRFFFGNWFDQGPRTACRYSLTRDRT
SPVLDHSGIAYLFAQLRTDFTSSEAGLSPPLTTQDECLGLAVLDLWRLAKEQQSSVKDLC
KSVSYKSCLPKSHRVDIEKRNWVERFRIRNTLKHFLKKFGSCAVDDCNLKLMYLTALAGI
QPSLGSETFHVDPSSSCLNSRSAVSLVQVTGEIGIQTSEGCEGVVWQTFCDFKEITDISI
KRICREQVPNDSRMVTITRKDDACLEVAFQSLKEALSLVSLVDGYFRLTTDSTHYFCQDT
APPSILEGIKNHCHGPITSEFAVNKLKKWGSEDGTFLLRQSPKTYGEFFLTVCLQTPLGL
DYKDCLVIKNKHYSLPGVSKSFSSLKELTVYYQQNKLLLADVPVRLSRCCPPRSQELTNL
IIMRNSSFVEAQLSPTLEGNKLIHIQFQMIKYEDLQWGESLGQGSFTRLFKGYKSNLSEG
GKRVSVFLKELDVNHRNLWESFFEAASLMSQFSHKHLILVYGVSVSGVKNIMVQEFVEYG
ALDLYLKRGRSVSVSWKLDVAKQLASVLTFLEQNNIVHGNICAKNLLLAREGDPSQSIPP
FIKLSDPGISVLMLGKDVIVDRIPWVAPEVLASPENLTLESDKWSFGATLWELFNNGNNP
LLGWDLDMKQKFYESFQQLPPSQWTELADLINQCMDYQADFRPSCRSIIRQLNSLITSDY
VILFATEPDTQNPAWRALTPSQQEQTVFEERHLRYISLLGKGNFGSVELCCYDPLGDNTG
ELVAVKKLQPSKKSSMEDFKKEVKTLSVLHCEYIVKYKGVCYSMGRLSMGLVTEYLPYGS
LIGYLENNRHKVDTRRMLLFASQICKGMEYLQSLRFVHRDLAARNILVASESLVKIADFG
LTKIIPCNKEYYRVTQPGESPIFWYAPESINESRFSHESDVWSFGVVLYELFSYCDINSN
PKRLYMQQIGHNVQTPSISLHLANILKSNWRLPAPPDCPAKVYSLMKECWLYDFMERPCL
LIPEETRLKSSCRMSETA
Download sequence
Identical sequences H3CXH8
99883.ENSTNIP00000012963 ENSTNIP00000012963 ENSTNIP00000012963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]