SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012977 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012977
Domain Number 1 Region: 182-404
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.5e-62
Family Tandem AAA-ATPase domain 0.0000401
Further Details:      
 
Domain Number 2 Region: 341-550
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.14e-46
Family Tandem AAA-ATPase domain 0.00045
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000012977
Domain Number - Region: 101-134
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.0267
Family MYND zinc finger 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012977   Gene: ENSTNIG00000010081   Transcript: ENSTNIT00000013169
Sequence length 615
Comment pep:known_by_projection chromosome:TETRAODON8:1:18774822:18777821:-1 gene:ENSTNIG00000010081 transcript:ENSTNIT00000013169 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFMPRALKVRRPVESTSQAKKSKVDQNESKDEESSVLPVQNEDTHEKLKKLDDTTHPDEN
TKTQDEQIKTLSDVPSQNSNLSELPVKSFKKLQRWPEPGEPVCVMCGRYGEYICDSTDND
VCSLECKASHLFHIKDNKDDKRTQQPAAHSRQLGGGEIEYSYREDQFISGLTGEQVQRIK
QELGIETQGSDVIRPVIEFEHCGFPATLSSNLKKAGYEAPTPVQMQMVPVGLTGRDVIAS
ADTGSGKTIAFLLPVVTRALKKAQSTAGPVALILTPTRELAIQIERQAKEVVMGLPNMRT
ALLVGGMPLPPQLHRLKQIIKIIIATPGRLLEILKQKAVQLDKVKVVVIDEVDTMLKMGF
QQQVLEVLEQVPEERQTLLVSATIPAGTEELAARLVRDPVRIVIGEKNQPCVNVRQILLW
VEEPSKKRKLFDILNDSKLYQPPVVVFVDCKLGADLLCEAVAKVTDLKTVAIHSDKSQRE
RNRILRGLLDGEFEVVISTGVLGRGLDLVNVRLVVNFDMPNTMDEYVHQVGRAGRLGHRG
TAITFLNNNNKRLFLEVVNRVKPTGSILPPQLLNSPHLHEQQRRQKQKAKHGFDDVLVTK
NSLLDIIRKHDRHKK
Download sequence
Identical sequences H3CXJ2
99883.ENSTNIP00000012977 ENSTNIP00000012977 ENSTNIP00000012977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]