SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013017 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013017
Domain Number 1 Region: 283-407
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.51e-26
Family Regulator of G-protein signaling, RGS 0.0021
Further Details:      
 
Domain Number 2 Region: 498-634
Classification Level Classification E-value
Superfamily PX domain 6.8e-22
Family PX domain 0.0027
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000013017
Domain Number - Region: 239-271
Classification Level Classification E-value
Superfamily ISY1 domain-like 0.0105
Family ISY1 N-terminal domain-like 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013017   Gene: ENSTNIG00000010119   Transcript: ENSTNIT00000013209
Sequence length 837
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:91898938:91907202:1 gene:ENSTNIG00000010119 transcript:ENSTNIT00000013209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDRALKEVFDLAYRDYILSWYVHLSHDEGQLYSMLSVDWWQMIGQLRSRLARIDLVNVVC
YDTIQILHTHFNDLKAASLRPEEGARPFPLHPCLVDPESEVAFLRCVARILLLCLLPQKD
AKSHTLRCCLTEVITTKAVLKPLVDVLSDPDSINRMLLSQLEKREQHLEQQKKAYTYAAS
YEDFIKLISTSVDVNFLKQLRYQIVVEIIHATTISNLPQLKKQKERKGKESAAMKADLLR
ARDMKRYINQLTVAKKQCEKRIRLLGGPNYENVEEGGTDDNDDPPSQKILQFDDILCNPA
YRERFRVYMERVDKRALIGFWELVESLKTANKNEVPQIVGELYQKFFVESREIPVEKCLL
REIQQSLVGNTGTQVFIKLQEQVSETMRERYYPSFLVSDLYDNLIRRDEQHSQSQRGTDE
KEGCQDLDPAEEEVCDECGKGINEQASYAATKLRQLRDKLDYKRHALESIQNAPKPDKKI
VSKLKEEIGSMEREHGELQQHMTRTDWWCENLGHWRANITAAEATEEGGEMVACYSVCVS
LVEGEESTNSRWNVNRKLPEFQMLHRKLTECFPSLKKLQLPSLSKLPFKSIDQKFLDKSK
TQLNAFLQRLLTDERLCQSEALYAFLSPSPEHLKVMSIQKKSSFSLASFLEKLPGDFFSH
TEEDDDDDSDLSDYGDETDGKKDALAEPCFMLIGEIFELRGMFKWVRKTLIALVQVTFGR
TINKQIRDTVNMIICEQMLVNYISVFKDAYWPGGRLAPHVKVRTDSERCETKEQAQQKLL
DNIPDAVINLVGQQNARNGIIKIFNALQETSANKHLLYVLMEMFLKEMCPELASEIA
Download sequence
Identical sequences H3CXN2
ENSTNIP00000013017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]