SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013033 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013033
Domain Number 1 Region: 208-313
Classification Level Classification E-value
Superfamily Cadherin-like 4.28e-22
Family Cadherin 0.0016
Further Details:      
 
Domain Number 2 Region: 89-206
Classification Level Classification E-value
Superfamily Cadherin-like 3e-20
Family Cadherin 0.0014
Further Details:      
 
Domain Number 3 Region: 2-88
Classification Level Classification E-value
Superfamily Cadherin-like 1.07e-17
Family Cadherin 0.00055
Further Details:      
 
Domain Number 4 Region: 315-390
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000314
Family Cadherin 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013033   Gene: ENSTNIG00000010135   Transcript: ENSTNIT00000013225
Sequence length 607
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:39206615:39233117:-1 gene:ENSTNIG00000010135 transcript:ENSTNIT00000013225 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTGTPVTRVTATDADDPVYGNSAKLVYSILEGQPYFSIDPNSATIKVALQGMDREMREEY
LVVIQAKDMGGHMGGLSGTTTVTITLTDINDNPPKFSKNLYEFVIPEDLPTGKMGGKVKA
NDRDTGENSKSTYGIVEGDDQGVFEIVTDSQTQEGILRLKKKPKQPLDYESKRAYTLKVE
ATNIRSEPGSGGPFKDTATVKIAVEDSDEPPVFSKPIYQLEVNENAPINTVIGSVMARDP
DSTGSQRVEKSIGGTPRKQFNINVDDGKITLAKPLDRETDMWHNITVTATEVSNTLGNHS
QISRAIVAIRVMDYNDNAPEFATEYETFLCENGKPGQVIQTISAVDKDDPIQGHYFNYRL
APEMLNNPNFTIKNNQVALFIFLSRPFELWVVSVFLKTTDEEGSLTPKTRQLFHNQGRKD
ALHKKVYLNIHSLRHVLCPVFLVDRVIVVLFVTLRRHKNEPLIIKDDEDVRENIIRYDDE
GGGEEDTEAFDIATLQNPDGINGYLPRKDIKPDLQFMPRAGQHSGPNGVDVDEFINVRLH
EADNDPTAPPYDSIQIYGYEGRGSIAGSLSSLETTSSDSDQNYDYLREWGPRFRRLGELY
SVGESDR
Download sequence
Identical sequences H3CXP8
ENSTNIP00000013033 99883.ENSTNIP00000013033 ENSTNIP00000013033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]