SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013043 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013043
Domain Number 1 Region: 112-373
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.44e-73
Family Protein kinases, catalytic subunit 0.0000000301
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000013043
Domain Number - Region: 386-431
Classification Level Classification E-value
Superfamily SH3-domain 0.000189
Family SH3-domain 0.0035
Further Details:      
 
Domain Number - Region: 6-68
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0377
Family SAM (sterile alpha motif) domain 0.014
Further Details:      
 
Domain Number - Region: 574-616
Classification Level Classification E-value
Superfamily UBA-like 0.051
Family TAP-C domain-like 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013043   Gene: ENSTNIG00000010145   Transcript: ENSTNIT00000013235
Sequence length 654
Comment pep:known_by_projection chromosome:TETRAODON8:20:625435:628691:-1 gene:ENSTNIG00000010145 transcript:ENSTNIT00000013235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVMDQDTQWLYQLLAEVQLEKFYLRVRDGLNITRQEHFAYVKESDLEQIGISKPAQRRLW
EALKRHKVKSRSWIPKVLGGRGGDAAEQPSGGSPAQGQESAGRALPCLIQDSELLLGEKL
GSGSFGVVRKGEWHAPAGRVLTVAVKSLRSSVSRQTDMLTDFLQEVTTMQSLDHPNIIRL
YGVVLTQPLKMVTELAPLGSLYDTLHARQYEYPLVRLWLFTTQIVSGMEYLETRRLIHRD
LAARNILLASREMVKIGDFGLMRGLSQEVDHYVMSAHRRIPFAWCAPESLRVGSFSHSSD
VWMFGVTMWEMFTYCEEPWFGLSGRQILWRVEREGERLEKPPDCPQELYAVMRKCWMCNP
HDRPNFTQLGTLVAEAKPKEVQTTRDFSEPRKLALAANDLVTLVEHSLEMSEWRGQNQRT
LAVGWFPASITMPPPPPSAVVVAPPPSSSGSGAVPIPVPNASFISTPLKGSLQHTGHGDV
HPQRSWGTPDSLDDEASIGPPPRPPPPNFKRPNMKSQRRPVVLPVPGAQWPPHVVASAAA
QPQIQNQPQQSASNLVKMAQMARSTPQLDDNADSRDRDRSREKVKVMEAVHGVTIEEADA
ALQRNEWNPVRAQQQLKLEQLYSLSLCSRDDCLRILSKYQWNLQLASRYLIRWS
Download sequence
Identical sequences H3CXQ8
ENSTNIP00000013043 99883.ENSTNIP00000013043 ENSTNIP00000013043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]