SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013080 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013080
Domain Number 1 Region: 111-210
Classification Level Classification E-value
Superfamily vWA-like 0.0000161
Family Ku80 subunit N-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013080   Gene: ENSTNIG00000010181   Transcript: ENSTNIT00000013272
Sequence length 344
Comment pep:known_by_projection chromosome:TETRAODON8:1:19563949:19566205:1 gene:ENSTNIG00000010181 transcript:ENSTNIT00000013272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LIFLAACGSMETPEPGPADGEERLVELRPRTRSNPEGAEDRRDSTGSLGGNPNPSMSQSA
VGNRVEGEGEASTSDSPPSSTSTAAAPQSAAPTAATEYQLRVPRVNCPEKVIICLDLSEE
MSLPKLESFNGSKTNALNVCQKMIEMFVRTKHKIDKRHEFALVVVNDDALWLSGFTSDPR
ELCSCLYDLDTNVCESFNLEDLLNVIRQKIELPLMENIQTIPPPYVVRTVLIYSRHAGQL
QFSPSEALSKMLQSPYFFFDVVYLHNGVEEQGDDSGWRENYTSFCNLDSKGMCYRFEVSM
SGPSIELHNCMAKLLAHPLQRPFQSHASYSLLEGEDPQDMEATV
Download sequence
Identical sequences H3CXU5
ENSTNIP00000013080 ENSTNIP00000013080 99883.ENSTNIP00000013080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]