SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013098 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013098
Domain Number 1 Region: 601-771
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.46e-40
Family Ankyrin repeat 0.00052
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000013098
Domain Number - Region: 106-133
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0105
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013098   Gene: ENSTNIG00000010199   Transcript: ENSTNIT00000013290
Sequence length 793
Comment pep:known_by_projection chromosome:TETRAODON8:1:19398988:19403494:1 gene:ENSTNIG00000010199 transcript:ENSTNIT00000013290 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQSVQMNPNLPDLASPFICSGRGEGDQPGSYSVQTPYGFQLDLDFLKYVEEIESGHNLR
RAPVGSRRSSRGPRLSQRSPSVGGRTSGWTSTESLSSPASEDGRAPPPPPPRNRLGSAPC
AKVPPPPPQRNPRVERTLLETSRRLQQEQTHQHQNAQPLQAKPSPQTSGLSTPAAAMTPI
PPSQLQTVREQMATALKQLKEMEERVKGVPALEKELAGLRAEKDALLLALEKAQRRQPTS
DSFTQTTETTKMHQGTQSRLTSPPSAVRGPGKAELGRLTEKFEGSRGRKDACEGPAVKLW
EKGTGTEVPVVRDQGAQTRVDTTEAEVWVMESLLGVTSEAQREMDALQDTVRFQQESIVA
LEKRLSEADKDLLALKAQLEERNSKDTSEKGVSAQPDLVDAQVETETPPLKHASAQSGAE
VAAAGVLKSIMKRKDGSSAEQSRTSSKKSLQFVGILNGGYESTSSEKEEEEEDGSSSDES
GDGECLDSTEDEAALDEETSEEERNVNLDESDTDEDTPSAYSSVAVKEKFEFGSKMREAC
LILRNHLNDEAKALRSKEVLSSTHTVQLEWFRVSSAKTAQPSRVSDYLMAFSEVSPVLLE
HVVNVTDGNGNTALHYSVSHSNFGVVELLLDTGVCSVDKPNKAGYTAIMLAALSTVKEEE
EDMGVVKKLFCQGNVNAKASQAGQTALMLAVSHGRQEMVRALLECGADVNVQDDEGSTAL
MCACEHGRAEIVQLLLEQPGCDISIVDNDGSNALSIALEASHNDTAVLLYAHMNYAKNQS
AGVSPSSRPCQPG
Download sequence
Identical sequences H3CXW3
ENSTNIP00000013098 99883.ENSTNIP00000013098 ENSTNIP00000013098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]