SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013147 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013147
Domain Number 1 Region: 1059-1161
Classification Level Classification E-value
Superfamily BRCT domain 2.88e-27
Family BRCT domain 0.0000816
Further Details:      
 
Domain Number 2 Region: 2-100
Classification Level Classification E-value
Superfamily RING/U-box 4.35e-17
Family RING finger domain, C3HC4 0.0014
Further Details:      
 
Domain Number 3 Region: 1171-1255
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000116
Family BRCT domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013147   Gene: ENSTNIG00000010246   Transcript: ENSTNIT00000013339
Sequence length 1262
Comment pep:known_by_projection chromosome:TETRAODON8:2:3396394:3410240:1 gene:ENSTNIG00000010246 transcript:ENSTNIT00000013339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAPTATDVKKRISLLWETLQCPICVDLMTAPVSSVCNFLRLCMSKQGKQSQMQNKVNQP
VCKVTITKRSLQDFKGFQRLISGLQEMTRAYETVTGSNYFTGLSQAQPPHVADIKAQHHN
KVSLMDASCAEGDYEEALPKSQSSTTAAQDGFARLMGLKDTSPLTTGLDSGLGEAPPTCD
KKMYSPTKVENVPLEPGFIPDEDERSDLQTPSKKKAKKDLEPDKILDQRQKKSLEKVAEW
LMNVPSEQSLELENPEEDGDDSDSRSSTSTIDLGQLHRGANPTRGRAKALEDQVFGAVYK
RERRGKEMVKPTEAALEVARFNLSVENTSEDENRGNKQEEHFIREREKNAGSNVLEGEVE
FLEDCRGSLEPTHMSENDENKEDEVPHPVSVIEEQQAETKGKRRTRSAPQHVDSDLLKCT
QKEPENTEPKRTQKRSRGIKSERAKSARTSKPLVLVAVENAEGGPKIGPRSEEVQVHIEN
YPSSGDQEVPSGRGTRKSRRLRGFTKEDTGKERSRSSVPDKEHRSHPKFECETLNNVKSL
DYKEQKWQDKNGCIYSQDMEEIENMDSGEKTSSRPEEGSEQTLFEVPDTETLFQAACSVA
ESTAQPSNTARLLTELEMENEQKNDSEQDTEQLVKSFKATKRKSFHLGSRPDVKRSRSSV
QENDQSAGAEENRYVCSVDPSAPKHAEPAAAGKTDTQVLVDSQNMPGSDLISDSHLASLK
RKASGLYSGCSAEGGCASASSPLPPNLESKHAGQSSKDSAICFATEKPSQISGSQANFMM
EDTQSSTLLQSVKADAAKELLNAPSSLTPSGLQTSVPGGEMTHSQSSRELSTRRKRAKAQ
KLDCLSDSSDCAEEEFPCLAKILNETASPGEHATRPPACPSPDCVNSSQASVDLFGTPHE
CAVNDVASSQFSSEVLVTQQKIEMKKELVRLEKLMALVSEVLHEKEASPAKDMLDKTTQK
ITGSDVDHVLSCGQGEVFNQETFPEEEQDANASLNDGKGARPAGSKHSSITELNSRISNT
VGLSSAAKTLKSDGSPSDGHEDKENNTPERARSLARMLLVTSGLGPSQQITVKKFAKRIG
ATVVSQVTPEVTHVVMHTDEQLVCERTLKYFLGIAGRKWVVSFQWISECIKQKKLLNETL
FEVRGDVVNGFNHQGPMKARATADNNVSLFHMHVCFFKQVTDISRTEMELMVELCGATVV
QDPLLLDGKRTSHQLIIVQSGSESSRSVSGKATVVTRGWLLDSVATYTIQNLKNYRADLR
AA
Download sequence
Identical sequences H3CY12
99883.ENSTNIP00000013147 ENSTNIP00000013147 ENSTNIP00000013147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]