SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013162 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013162
Domain Number 1 Region: 11-353
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.35e-90
Family Regulator of chromosome condensation RCC1 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013162   Gene: ENSTNIG00000010259   Transcript: ENSTNIT00000013354
Sequence length 472
Comment pep:known_by_projection chromosome:TETRAODON8:3:1562464:1565216:-1 gene:ENSTNIG00000010259 transcript:ENSTNIT00000013354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGEAEDEIPETGAVFTFGKSKFADNIPSKFWLKNDVPSQISCGDEHTALITKNGRLFMF
GSNNWGQLGLGSKVTVNKPTCVKALKSEKVLLAACGRNHTLICTGEGRVFSSGGNSEGQL
GLGDCEERTTFRRIHALDSLGPIKMLAAGSNTSAALTESGKLFMWGDNTEGQIGLGKESH
APWPQEVSVGAPVSWVSCGYYHSALVTAAGALYTFGERDSGKLGLTTEQLPRHRVPQPVR
SIGEPVRQVACGGGHTVALTEDRLFTFGLGQFGQLGHGTFVFESRLPRLVEHFKKGRVRQ
VACGENHSAVITDGGLLYTFGDGRHGKLGLGDENFTNQFKPTLCSRFLKYGVQAVGVRRA
GPRLLPSRRLFSPAVFAACLQATLPCLPFYASSILSSQGTVSSSKITCLDDCECRTMSGL
RLVSTMFSGNFNCFPRSTLSCQSLPVARRPGWALGWGGGCSPAPDKPNSASR
Download sequence
Identical sequences H3CY27
ENSTNIP00000013162 ENSTNIP00000013162 99883.ENSTNIP00000013162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]