SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013166 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013166
Domain Number 1 Region: 11-133,161-261
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.83e-43
Family Ankyrin repeat 0.0000721
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013166   Gene: ENSTNIG00000010263   Transcript: ENSTNIT00000013358
Sequence length 287
Comment pep:known_by_projection chromosome:TETRAODON8:3:1601957:1603377:1 gene:ENSTNIG00000010263 transcript:ENSTNIT00000013358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAELLGRQDADGDTVLHIAVAQGKRALTYVLALKMAAGGELDLKEHNGQTALQIAAATNN
HLIVRDLLTHGAKVNTRDLWGRSPLHVCAQKGHALSLQAIWRTLQRTRQQPDLEMYNYDG
LTALHAATVSHNAVVKELRDAKPLCAYRSAELEEKREAYAATVRTLLLMGASAGAKDLKS
GRTSLHMAAEEANEKLLRLLLSSPSAAAAINATAFNGNTVVHAVCALQDSGSRAAAAAKL
LLRRGADPAVRNLENELPWQLAPEGPAGEQVLTAGGRSRPLTPVLTV
Download sequence
Identical sequences H3CY31
ENSTNIP00000013166 ENSTNIP00000013166 99883.ENSTNIP00000013166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]