SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013173 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013173
Domain Number 1 Region: 381-586
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 6.24e-48
Family ATP-dependent DNA ligase catalytic domain 0.00023
Further Details:      
 
Domain Number 2 Region: 596-739
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.03e-35
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.0002
Further Details:      
 
Domain Number 3 Region: 2-98
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.41e-29
Family PARP-type zinc finger 0.0000105
Further Details:      
 
Domain Number 4 Region: 808-884
Classification Level Classification E-value
Superfamily BRCT domain 0.000000000113
Family DNA ligase 0.00043
Further Details:      
 
Domain Number 5 Region: 160-394
Classification Level Classification E-value
Superfamily ATP-dependent DNA ligase DNA-binding domain 0.000000000589
Family ATP-dependent DNA ligase DNA-binding domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013173   Gene: ENSTNIG00000010270   Transcript: ENSTNIT00000013365
Sequence length 885
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:27326683:27331722:-1 gene:ENSTNIG00000010270 transcript:ENSTNIT00000013365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEQRFLVEYAKRGTAGCKKCKDKIVKGIVRIGKIVPNPFSESAGEMKEWYHVKCIFEKL
ERARATTKKIEDLTELEGWEELQDEDKNLIKEHISELMAKVNASPKKKVQAKLNTSGHLM
APPADPSVNAPRKFSGFTGKQQHLHPLMSSSTPGSSLSSQLCNPQHKDCLFREFRKLCAT
VAENNSYNAKTQIIEQFLRKGSGGDKFHGDLYLTIKLLLPGVIKSVYNLNDKQIVKLFSR
IFRCNQEEMVRDLEQGDVSETVRVFFDNSKSFPPASKSLLTIQEVDASLTRLAQLTKEDE
QQSELESIAKKCTSNDLKCIVRLVKHDLKMNAGAKHVLDAVDPNAYDAFKASRNLGDVID
RVLRNQQEASNGSGPRKLLTVEATLMTPVQPMLAEACKSVEYAMKKCPNGMYSEIKYDGE
RVQVHKNGDSFSYFSRSLKPVLPHKVAHFKDYIPQAFPGGHSMILDAEVLLIDTQTSKPL
PFGTLGIHKKAAFQDANVCLFVFDCIYFNGTSLMERPLCERRKFLHDNMVEVPNRILFSE
MKHVTRAADLADMITRVIREGLEGLVLKDVKGMYEPGKRHWLKVKKDYLNEGAMADTADL
VVLGAFYGKGSNGGIMSSFLMGCFDPDSKKWCTVTKCSGGYDDAMLARLQKELDVVKISK
DPSKIPQWLKIVKNYYPDFIIRNPEEAPVWEITGAEFSKSEMHTADGISIRFPRMTRIRD
DKDWKSATNLHQLKELFRISKENCDFKVTTGTSDNDKASSGESGGHSPPASSRGGAVPKR
KSTEGPTKAKAVKSQPRNPGPEAPSAKKTLLDIFSGVKLFLPLTVQDFDKLRRYFVAYDG
ELVPEYDAAAATHTMAEPEDDSGAQRVTPSWIWECIRKRRVVPPC
Download sequence
Identical sequences H3CY38
ENSTNIP00000013173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]