SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013176 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013176
Domain Number 1 Region: 9-252,284-421
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.57e-66
Family Regulator of chromosome condensation RCC1 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013176   Gene: ENSTNIG00000010273   Transcript: ENSTNIT00000013368
Sequence length 424
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:27395327:27398111:-1 gene:ENSTNIG00000010273 transcript:ENSTNIT00000013368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KDDPGPVFQYVGKHKKPNHKVFVWGFSFTGALGIPSFVVPDSGRKKPRKYQLTPYRLDTA
EQISSAACGYGFTLIASRTKDVIKLWGMGLNKDSQLGFQRTQQSRLDSYEYVLEPSPVAL
PLAEPQQTRVLQVSCGRAHSLVLTDNEGVFSMGNNAYGQCGRRVVEDEVYSGSHVIHRIE
GFRSPVVQVACGQDHSLFLTQTGQVLACGWGADGQTAGLCGLSVVSTLVSLVSGLSGVES
LSDLSGIGDLWSLWSWSHWSLCSRYGVSLVTLVSLASVTQVTQINSPRHLPVEGCGKVVQ
AACGGTQVAVLNDKGEVFVWGYGILGKGPNLSESSTPEMIPSTLFGRSDFNPTAAVTRIR
CGLNHFAAVTDGGELFVWGKNIRGCLGIGKRDDQYFPWRVTVPGQVVDVACGVDHMVALV
KSLL
Download sequence
Identical sequences H3CY41
ENSTNIP00000013176 99883.ENSTNIP00000013176 ENSTNIP00000013176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]