SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013181 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013181
Domain Number 1 Region: 24-151
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 3.92e-57
Family N-terminal domain of cbl (N-cbl) 0.000000328
Further Details:      
 
Domain Number 2 Region: 238-324
Classification Level Classification E-value
Superfamily SH2 domain 2.96e-48
Family SH2 domain 0.0000027
Further Details:      
 
Domain Number 3 Region: 330-408
Classification Level Classification E-value
Superfamily RING/U-box 8.52e-42
Family RING finger domain, C3HC4 0.00000964
Further Details:      
 
Domain Number 4 Region: 153-237
Classification Level Classification E-value
Superfamily EF-hand 3.33e-37
Family EF-hand modules in multidomain proteins 0.00000898
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000013181
Domain Number - Region: 789-823
Classification Level Classification E-value
Superfamily UBA-like 0.000306
Family UBA domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013181   Gene: ENSTNIG00000010278   Transcript: ENSTNIT00000013373
Sequence length 835
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:27470413:27475097:-1 gene:ENSTNIG00000010278 transcript:ENSTNIT00000013373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLIGLMKDAFQPHQQPPQPQQPAAVDRKMVEKCWKLMDKVVRLCQNPKVALKNSPPYILD
LLPDTYQHLRTILSRYEGKMEILGENEYFRIFMENLSNKTKQTMSLFKEAKERMYEENSQ
PRRNLTKLSLIFSHMLAELKAIFPNGLFQGDNFRITKADAAEFWRRSFGDKTIVPWRTFR
QALHEFHPISLGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSLLRNWNCLAVTHP
GYMAFLTYDEVKARLQRFIHKPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQ
ALIDGYREGFYLFPDGRAQNPDLTGLCEPSPQDHIKVTQEQYELYCEMGSTFQLCKICAE
NDKDVKIEPCRHLMCTSCLTAWQESEGQGCPFCRCEIKGTEPIVVDPFHPKANGAAFAGF
QVSGRAEAAGNDEEEDDRLEDQQLMMSRLACSKVERPPSPVSQLPPVPPRLDLLQQRASS
SHSAPGQGATAKVVHAESSPHRDKPLPLPPSLRDLPPPPPPERPPLVGQDSRLQRRPLPS
TPDQSAWSSNYMVPRPAAKAGPVPPGPGSSAQVNGSGAEGPRAQAASNAVYCLSARYLQL
RRPSGGQTPPSDGEENEYMSPTSLPAPGSSWMAAGSSVPPAPGQTQQQGDVRDCEDPQVY
ESMCNIHSGPCEAAPDAELGSFGLTRQDQGPGPDVDVDEDVYEYDCPRAAAPAPPTRRTL
SDISGPSAALGALSIDSLETSLLAAGDDPERPPKPLPRRTNSDRRPRPANRGLSLPVAGG
PGNVALNGEIECLMSQGYSIQDIQKALMIAQNNLETAKNILREFVSVPSAAHIAT
Download sequence
Identical sequences H3CY46
ENSTNIP00000013181 99883.ENSTNIP00000013181 ENSTNIP00000013181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]