SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013196 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013196
Domain Number 1 Region: 20-307
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.62e-45
Family FCH domain 0.022
Further Details:      
 
Domain Number 2 Region: 570-653
Classification Level Classification E-value
Superfamily SH3-domain 9.84e-20
Family SH3-domain 0.0009
Further Details:      
 
Domain Number 3 Region: 472-537
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000197
Family SH3-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013196   Gene: ENSTNIG00000010293   Transcript: ENSTNIT00000013388
Sequence length 749
Comment pep:known_by_projection chromosome:TETRAODON8:10:9968686:9995035:1 gene:ENSTNIG00000010293 transcript:ENSTNIT00000013388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPPPRKVKVTQELKNTHAEQMTRLHFKHQTECDLLEDMSLRRSYSMKKGQLERDYAQAL
QKLASQYLKRDWPGINPDDQRTDYRNVYAVWRSYLEGTVQVSQSRLNVCDNYKSKVSEPA
KTVRLYKEQQLKKIIDQLSCIQAELQESVKELAKAKKKYYDCEQVAHAVREKADIEAKSK
LGLCQSRISLQKASLKLKAKRSDCNSKATQARNDYLLTLAAANAHHDRYYHTDLLHCIQA
LDGRIYEHVKDYLVALCHTELEASQATHNTFQFLLDKSTRIIQEFNQQLFMQENPVFHKA
QDFQFQPSEYDTVRHTAPQTSASQEHFQPLEIVSHCDEVVCSNNVKCQFKVRAALTSHIG
ICVNTEISQWNSQKWTVTRESIKNQKTVKLKAEARLDLLRQVGVAVDTWLKSAMNQVMEE
LENERWASYTSHDPSLSGTVDLEREEGEECEENMEVFDDSSSSPSGTLRNYPLTCKVLYS
YKASQPDELTIDEQEMLEVIEDGDMEDWVKARNKTGQVGYVPEKYLQFPTSNSLLSMLQS
LATLDARSHTSSNSTEPELHSNCINGDTTTVTYVRALYDYEGQADEELSFSEGAVIRLLS
RDTQTDDGFWEGELNGRVGVFPSVLVEDLTENGENSGAGTGDVQISPSLKLSSALPPLPL
YDQPPISPFTSPETSTPPPLPRSPSATLNDQSSGKTAVSPGFPQPLRFTPEESPNFRLQV
RAAPPPPKQHPRRQQEKSDKSEEVEITLV
Download sequence
Identical sequences H3CY61
ENSTNIP00000013196 99883.ENSTNIP00000013196 ENSTNIP00000013196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]