SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013222 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013222
Domain Number 1 Region: 19-161
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.02e-28
Family Voltage-gated potassium channels 0.0028
Further Details:      
 
Domain Number 2 Region: 149-216
Classification Level Classification E-value
Superfamily E set domains 0.000000000000119
Family Cytoplasmic domain of inward rectifier potassium channel 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013222   Gene: ENSTNIG00000010318   Transcript: ENSTNIT00000013414
Sequence length 216
Comment pep:novel chromosome:TETRAODON8:Un_random:18903524:18904182:1 gene:ENSTNIG00000010318 transcript:ENSTNIT00000013414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RQRYVQKDGKCNVHHGNVKETYRYLSDLFTTLVDLRWRFSLLIFTLVYVVNWLFFGFLWW
LIALIRGDLVHADDEGWTPCVENLNSFVSAFLFSIETETTIGYGYRVITEKCPEGIILLL
VQAILGSIVNAMMVGCMFVKISQPKNRAETLMFSHKAVISINIGFDTGDDRLFLVSPLII
SHEINEKSPFWEMSLAQMEKEEFEIVVILEGMVEAT
Download sequence
Identical sequences H3CY87
99883.ENSTNIP00000013222 ENSTNIP00000013222 ENSTNIP00000013222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]