SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013228 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013228
Domain Number 1 Region: 415-677
Classification Level Classification E-value
Superfamily YWTD domain 6.93e-49
Family YWTD domain 0.000000127
Further Details:      
 
Domain Number 2 Region: 242-285
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000017
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 3 Region: 121-161
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000589
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 4 Region: 207-247
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000641
Family LDL receptor-like module 0.00058
Further Details:      
 
Domain Number 5 Region: 4-41
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000353
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 6 Region: 160-200
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000127
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 7 Region: 43-81
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000275
Family LDL receptor-like module 0.00088
Further Details:      
 
Domain Number 8 Region: 369-409
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000401
Family EGF-type module 0.0013
Further Details:      
 
Domain Number 9 Region: 290-326
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000864
Family LDL receptor-like module 0.00037
Further Details:      
 
Domain Number 10 Region: 80-122
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000956
Family LDL receptor-like module 0.00057
Further Details:      
 
Domain Number 11 Region: 333-375
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000703
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 12 Region: 680-727
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000115
Family EGF-type module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013228   Gene: ENSTNIG00000010322   Transcript: ENSTNIT00000013420
Sequence length 822
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:23487192:23516785:1 gene:ENSTNIG00000010322 transcript:ENSTNIT00000013420 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTKTECEASQFQCGNGRCILSVWQCDGDDDCTDGSDENSCVQKTCAESDFVCQNGQCVPK
RWHCDGEPDCEDGSDESLDICHTRTCRLNEVSCGAGSSNCISVFWKCDGEKDCDNGEDEV
NCGNITCAPNEFTCASGRCISRNFVCNGEDDCGDGSDEVACAPSSCAPSEFQCGNSSCIP
ASWVCDDDVDCQDQSDESPSRCGRHPTPPAKCSSSEMQCRSGECIHKKWRCDGDRDCKDG
TDEANCPVRTCGLDQFRCDDGTCIPGSKQCNGLRECPDGSDELNCKNVTQCSGPDKFKCR
SGECIEMSKVCNKVRDCPDWSDEPIKECNFNECLLNNGGCSHICKDMVIGFECDCTPGLQ
LIDHKTCGDINECLNPGICSQICINLKGGYKCECHNGYQMDPTTGVCKAVGKEPCLIFTN
RRDIRRLGLERKEYTQLVEQQRNAVALDADFNQQMIFWADLGQKAIFSSVRCLTNEGKSE
HTEKLIDHVQTPVGIAVDWVYQNLYWSDLGPKTISVSNFNGTKAKVLFDRSLKEPASIAV
DPLSGVLYWSDWGEPAKIEKSGMNGVDRQVLVASDIQRPNGITLDLIKGRLYWVDSKLHM
LCSVDLNGDNRKKVLQSSEYLAHPLALTVFEDRVFWTDSDNQAIYGANKFSGSDVTTLAS
NLNNPQDLIVYHELIQLSGTNWCAENGENGGCSYMCLPAPQINKHSPKYTCVCPDGQELA
AERLTCKKKANVSTSIQVDSTARGSAAAWAILPVLLLAMAAAGGYLMWRNWQLKNQKSMN
FDNPVYLKTTEEDLNIDITRHGANVGHTYPAISIVSTDDDLS
Download sequence
Identical sequences H3CY93
ENSTNIP00000013228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]