SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013249 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013249
Domain Number 1 Region: 179-433
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-39
Family YWTD domain 0.000000295
Further Details:      
 
Domain Number 2 Region: 54-150
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.44e-25
Family Thyroglobulin type-1 domain 0.00056
Further Details:      
 
Domain Number 3 Region: 23-68
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000181
Family EGF-type module 0.0054
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000013249
Domain Number - Region: 4-31
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00409
Family EGF-type module 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013249   Gene: ENSTNIG00000010343   Transcript: ENSTNIT00000013441
Sequence length 442
Comment pep:known_by_projection chromosome:TETRAODON8:3:3850842:3866110:-1 gene:ENSTNIG00000010343 transcript:ENSTNIT00000013441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTAQCVPLGGQEFQCQCATGYRGDGRNCYDIDECSSSPCHINGRCVNRLGSFDCHCQPGF
YGDGFLCSQLAAQPERTKTQCEHHRDSVQSTGPEGYPVVGAYVPQCDDNGLYRPLQCHGS
TGYCWCVDSNGQERAGTRTPPGTQPTDCDGPGLPSVAPPTVRPLPRPDVTPPPHADVTLL
YAQGQKIGALPLSGTRLDETSARTLLTLHGSIVVGLAYDCKENHVYWTDLSARTINRAAM
APGAEPEILINTNLVSPEGLAVDPNRRLMFWVDSNTDLIETSNLDGSGRRTLFGTELVNP
RAIIVVSSTGTLYWTDWNREAPKIESSTVEGQNRKVVVSDGIGLPNALTYDTTSGQVCWA
DAGTKRLECVFPDGTGRRVVHPSLNYPFNMVYYRSHFYFTDWRRDGVIAVNKESSQITGE
YLPDQRSHLYGITIATSHCLSG
Download sequence
Identical sequences H3CYB4
ENSTNIP00000013249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]