SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013261 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013261
Domain Number 1 Region: 1267-1566
Classification Level Classification E-value
Superfamily BEACH domain 1.96e-126
Family BEACH domain 0.0000000121
Further Details:      
 
Domain Number 2 Region: 1686-1941
Classification Level Classification E-value
Superfamily WD40 repeat-like 8.98e-34
Family WD40-repeat 0.0015
Further Details:      
 
Domain Number 3 Region: 1182-1234
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000516
Family PreBEACH PH-like domain 0.0092
Further Details:      
 
Domain Number 4 Region: 49-196
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000301
Family Laminin G-like module 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013261   Gene: ENSTNIG00000010355   Transcript: ENSTNIT00000013453
Sequence length 1969
Comment pep:known_by_projection chromosome:TETRAODON8:3:4044446:4058266:1 gene:ENSTNIG00000010355 transcript:ENSTNIT00000013453 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPSRHLLRELMNMLLRPPDSSKAHPYVGPALRSLLAMVRKQGLESAMQYFDLSPSMAGIV
VPTVQRWPGSSISFFAWLSLDQDQLGPSSKDKRKQLYSFFTPGGTGFEAFISSAGLLVVA
VCTKKEYVTVLLPDYCFCDSLWHSIGVVHIPGKRPFGQSLVYIYVDGQQKLSAPLKYPIM
TEPFTSCCIGSAGHRTTTPPPSQIPDPPFSSSTTPTTRSSLGGILSAQTWGGLLGTKSES
MTKIISAGTQDSEWGSPTSLQGQLGTVMVFHEPLNSSHIKAICSAGPNCISPFKTQESEL
GDLSTKLLLHYSPKACKNPICLDLSPNMLHGRLTGNKVVNWDIKDMINCVGGLSVLIPIL
EQLSLTTSEQQDPAAGSDFITPDVVTPADEDWVILPTNRASETRLEKNLVAIFLLVLKHF
LQRHAINQENFLHSHGVSTLGVLLQKLPAGHVDVSVLVAVQLLIEQVTYEKNQNMLQQLH
THLLFNFNIWNKGDFALRIGHIQYMSTVIKDNKKQFRKKCGVQFLLDTVRLYYGKNSNKE
SDLSEDDIRTVRASLYSLIKYYITKGMSHPEMLSILGYIAAIGDEDQLFERMLRFDRVHE
KNKQRLRLRESGYSGLSLLFSDLHITPSLIRCLLNQILHTVSHLMAYEGGESGNQTPGSM
PSTPSPLDTSKPFPGTADRDANSSMTEDSFLFSDNISLGESFNNVSVSSQRAEEDLCSLL
LEIVSWVMWRGVEGSDDLAWLERGQVFSALTKLGTANELLLPLDHIKLSLMERMLEWAVT
DNREASTATLPQHTENAVRLLHIVQDFLQAEGLVNPALWTEKVLEETVTLMDSLMVWYSA
GTQWFQLCQVGLRLLLGFMAQEDPNVCAMATAKLNGILQTKEVSSQDEACYLLGKVEGIL
RRSMLEQTEETYSFLVPLLRTLLSKVHRLLYMELHLPQLPDTNGSPSFFEDFKIYCNSPE
WRVYLDKYIIPYMKQYEIEIFSQGHETMALYWKDCYEAFMVSLHKRERERGESKIRFQEQ
FVEPFSRRSRQENLRYNSMLKQQLSQNSAILRQWKAARRGLVCERGPWADRQQSEMHWRV
STAENYSRMRLKLTRNYNFDPHREASALRDNLGKMTLLLCGLHTRTFLPFFDTRQTVPPT
MLSYQITGNGVHHERESPESLLLEAVKQVKFSDLNAEKKQKHLRVGHDFKWPLSQIRKVH
LRRYNLRRSALEIFLIDQTNYFLNFQKEVLNYNFCFHLIQSNIVRSSQNRYTNVRNKVYS
RMLQLRSLSFHGTRSPQELLKASGLTQKWVNREISNFDYLMQLNTIAGRTYNNLAQYPVF
PWILADYTSEELDLSDPRVFRDLSKPVAVLNERNAKVVREKYDNFEDPTGTIDRFHYGTH
YSNAAGVIHYLIRVEPFTSLHIQLQSGRFDCADRQFHSIPATWQALMDNPNDVKELIPEF
FYFPEFLENQNDFDLGRLQMSKDRVNDVILPKWAKSPEDFIYKHRKALESEYVSAHLHNW
IDLIFGYKQRGPAAVEALNVFYYCTYEGAVDLDAITDEKERKALECMISNFGQTPCQLLK
EPHPLRLTLEEVEKRRAQLDSCALSMFEHLGELKSFFVEGISDRVPLVKVVVPKNQSHSF
ITQGSPDTMVTVSQNCLIGTHGWLPYNKNISNYFTFIKDPTVSNAKTQRFLSKPFAPGVD
VTAALFVVSHDGKLLFSGGHWDNSLRVTSLVKGKTVGLLIRHMDIVTCLSTDHCGIYLIS
GSRDMTCMVWQIQQQGGTPVGLCPKPVQVLYGHTDEVVSVSISTELDIAVSGSRDGTVII
HTVRRGQYMRCLRPPCDTALPVSILHLAVSWEGHLLVHTCIEGKATLKDKNTLHLYSVNG
KHLCSELLEEQVTDMCVSGEYVVIGSEQGQLSIRNLYSLSLCMEPMAMRVPIHCVSVTKE
QSHILVGLEDGKLIIVGVGKPAEIHLGQISRMLWGSSKTRTQVSGESAY
Download sequence
Identical sequences H3CYC6
ENSTNIP00000013261 ENSTNIP00000013261 99883.ENSTNIP00000013261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]