SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013299 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013299
Domain Number 1 Region: 285-443
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.69e-55
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000281
Further Details:      
 
Domain Number 2 Region: 123-283
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.02e-46
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000675
Further Details:      
 
Domain Number 3 Region: 86-124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000104
Family EGF-type module 0.016
Further Details:      
 
Domain Number 4 Region: 42-90
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000299
Family EGF-type module 0.011
Further Details:      
 
Domain Number 5 Region: 3-38
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000157
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013299   Gene: ENSTNIG00000010392   Transcript: ENSTNIT00000013491
Sequence length 444
Comment pep:known_by_projection chromosome:TETRAODON8:13:12931897:12936283:1 gene:ENSTNIG00000010392 transcript:ENSTNIT00000013491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GDLCQVNHCTNGGTCVTGEGQRLICICPDGIDGETCNETESGPCSPNPCQNDGVCQVTGS
TRRGDVFGEYVCRCPPGFDGVHCQNNVNDCAGQPCENGGVCRDLEGDFKCHCPSPFVGKH
CQLRCISLLGLQGGGIAESQISASSVRYAVMGLQRWGPELARLHNKGLVNAWSAAAHDRN
PWIQVNMQRKMRLTGIVTQGASRIGSAEFIKAFKVASSLDGRTFTVYRTEGQSRDHVFVG
NVDNDGTKTNLLDPPLIAQFIRLIPLVCRKACTLRMELVGCELSGCSEPMGMKSRLVSNR
QITASSTFRTWGMEALAWHPPARLDKQGKTNAWTAANNNRSEWLQVDLESPKKISGIITQ
GAKDFGSVQFVSAFKVAHSDDGQSWTTVKDETTRTDKIFPGNSDNNVHKKNILDPPIYGR
YVRILPWEWHGRITLRMELLGCDE
Download sequence
Identical sequences H3CYG4
ENSTNIP00000013299 ENSTNIP00000013299 99883.ENSTNIP00000013299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]