SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013301 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013301
Domain Number 1 Region: 648-783
Classification Level Classification E-value
Superfamily C-type lectin-like 1.45e-42
Family C-type lectin domain 0.00000704
Further Details:      
 
Domain Number 2 Region: 122-235
Classification Level Classification E-value
Superfamily C-type lectin-like 6.28e-41
Family Link domain 0.0019
Further Details:      
 
Domain Number 3 Region: 238-335
Classification Level Classification E-value
Superfamily C-type lectin-like 1.89e-26
Family Link domain 0.003
Further Details:      
 
Domain Number 4 Region: 783-847
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000005
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 5 Region: 13-126
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000179
Family V set domains (antibody variable domain-like) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013301   Gene: ENSTNIG00000010394   Transcript: ENSTNIT00000013493
Sequence length 881
Comment pep:known_by_projection chromosome:TETRAODON8:13:12940472:12947348:-1 gene:ENSTNIG00000010394 transcript:ENSTNIT00000013493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DGSLRVSIPLERPLHPVLGSKVLVPCYFQDNIAKDPGAPTVAPLSHHIKWTFITKEKISR
ILVASEGKVHVETEYLDRVTMINYPLVSSDASIEITELRSKDSGTYRCEVIHGIEDNYDS
VTIQVQGIVFHYRAITSRYTLTFEEAKAACVQNSATIATPAQLQAAYDDGYHQCDAGWLS
DQTVRYPIHQPREPCYGDKENFPGVRTYGVRDVNETYDVYCFAEKMSGQVFFTSDYDSFS
YDEAVLHCRKLNATLATTAQIYAAWSQGLDECRPGWLLDRSVRYPISTPRPHCGGGQVGV
HTIYAFPNQTGFPDEHSRYDAYCFQGTAETTKVYGETETSVNITEIEDLIKKTIIIPEDA
VPSGREDSQSRALACTLKFLVKESGSGSGLEHSASCNTAKESSTSSTSGEVSGSAKEPSG
DHSGSGEPQEAEGGSAVMFTSGDLGSASASGSGSGSGLLSGSGLMSGSELMSGSGLLSGS
GVSSGLGSGESSGISLVDHVAVHLTPGLPDEREVSGYIESISCSGFLSGDSGSGSGSGDR
LPGDVTYLTDPDLFEMTVPPPTSLPEQGRGVVEISGAGSGSGMSGNGPASHGSGQSGSDV
DPPASEPRPDLSYSGPTAPSLSIPTPAVVEEPEAVKGVCYLQLPQSGWALEHTFMSGCPE
GWLEFKASCYLHVAETDTWSEAERRCQELNAHLVSITSREEQQFVNSNGQDYQWIGLDDR
DVQNEFRWTDGSPLNFENWSANQPDDYLGSGEDCVVTMSHEDGRWNDVPCNYHLPFTCKT
GPVTCGAPAEVEHGRPMGGGQQRYTVNSRVRYQCEEGFVQRHLPVIRCMSDGQWEEPRVK
CTQGRCVWRLPDSDPNPDVNTLAGVNSFSLSPPSAAVPNGP
Download sequence
Identical sequences H3CYG6
ENSTNIP00000013301 ENSTNIP00000013301 99883.ENSTNIP00000013301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]