SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013317 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013317
Domain Number 1 Region: 45-408
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.57e-52
Family Ankyrin repeat 0.0000333
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000013317
Domain Number - Region: 533-574
Classification Level Classification E-value
Superfamily SOCS box-like 0.0194
Family SOCS box-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013317   Gene: ENSTNIG00000010410   Transcript: ENSTNIT00000013509
Sequence length 583
Comment pep:known_by_projection chromosome:TETRAODON8:13:13053406:13056011:-1 gene:ENSTNIG00000010410 transcript:ENSTNIT00000013509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYEDEEEGEEQLSDRVIQLSLHESCQESFLSLAAGTDENLRVAAAVEQGEVLLLSQLLQQ
SGAFQQRDGRGWLPLHRAAVQPVPEVLRTVLRSATQRRSLEERTAAGESALTLALKAGRA
HNVSALLEAGASPHAANGSNETPLAAAVKAGSYEMTHALISCGAWAEQVCWRKWTATHEA
ARLGRADILMLLLRNGGRVNHKDLTGVTPLAVAAEHGHAHIAELLLSCGGRVNAQACNGD
SVLLDAAGSGSTACIRLLLDHGADANLASATGHLPIHKAYAGHHQALKMLMPLTSRRAIK
AAGQSPVHSGAEGGRARCLELLLAGGFDVNYRMEARKAENYRDLRRTALYFAVSNGDAEC
TRILLAAGARTDLDPLSCLLVAVRSGRYDLVELLLASRADVNRCFTAVSDTLFPTALQYC
LKDEAMMRLLLNNGYDADKCFQCHHGDAAATGKIPVSLGRAAAPPVGAESQRRCSSLQFC
EFIGLCCVLHLSGKVVRILLDYTGHVRICPRLHSILEKQAQWPEIRQVLVLAPVGHLCRL
QMRRSLTLRRLNNPKVMNSHIIPPRLKRFLLYQELELSSSTGP
Download sequence
Identical sequences H3CYI2
99883.ENSTNIP00000013317 ENSTNIP00000013317 ENSTNIP00000013317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]