SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013324 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013324
Domain Number 1 Region: 415-618,737-793,828-876
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.74e-59
Family Ankyrin repeat 0.00042
Further Details:      
 
Domain Number 2 Region: 149-380
Classification Level Classification E-value
Superfamily VPS9 domain 2.09e-49
Family VPS9 domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013324   Gene: ENSTNIG00000010417   Transcript: ENSTNIT00000013516
Sequence length 906
Comment pep:known_by_projection chromosome:TETRAODON8:13:13146449:13155937:1 gene:ENSTNIG00000010417 transcript:ENSTNIT00000013516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VWQGPARLLHMAVYDEDLLKNPFYVALEKQRPDLCSRVAQVHGVVLVPCCSSLAVSSFSD
SQFDSYVLQPVEDGFRTLDGKAVQIQDRQVLLGSGFPALAPVPILFDETFYNDQEQSYSV
LCISRPIEVDPGLPEPGRREPGRLPPSSLQDVRDFLGPHAQKLDKLIQSFCQAFRQQERR
GLRHHIDSVHALYTRCLQCLLRESRLKLLVKEELQMNLLKQAVETYVHHRIHDLIFTFVG
TLEASQDAAFNKTSRSLQELQQKDLGVTPEFSINLSRAKRELSRLNQQTAPLLKLLCLRR
VVLTAVQSPRRTAVRIEAVGADDLLSVVLYLLVKTEIPNWMANLSYIRNFCFSRCSQDEL
SYCLSTFEAAVEYINLGRLKDTHAVSPDSASFSQKLLLQARMSQLTQNATPTHRLFEHIA
KGNKEAVEELLSEAERDEELRLCHPLCSCDLCDLQLSGRWNDPSVVTPSSRDDRGYTPLH
LAAACAGQSQLIDLLVCKGASVNATDYHGLTPLHLACQRGHQGVTLLLLHYQANTDAQDN
NGNTPLLLACTYGHEDCVKALVYYDMQTCHLDLQNDKGDAALHLAARWGYEGIIQVLLEN
GADAHLLNRSRASPLQCALNAKILMLLQSNQNGRQHTRSGFTVSVSSSPQTSDHSSRRSS
VSSTSSLGSQVQPEGERVRHREVEKLLRAVADADVEMVRFLLEWTDEEEEDEEQQPQTRL
CHPLCQCPSCSPAQKQTSVLQAGVLGVNSCNVHGFTPLHVAALHGHSLLVRLLLRHGAAI
NARTNHSATPLHLASQNSHVQSSPRSIPTTTGLPDHPRITKHTSISFACLCGNLETATIL
LGSDAQVNVANLQGNAALHEAVRRGHLALVELLLRGKASASLKNRKQRTPLDCAYEQNTE
ILRALQ
Download sequence
Identical sequences H3CYI9
99883.ENSTNIP00000013324 ENSTNIP00000013324 ENSTNIP00000013324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]