SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013356 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013356
Domain Number 1 Region: 308-484
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-60
Family SPRY domain 0.0000213
Further Details:      
 
Domain Number 2 Region: 20-71
Classification Level Classification E-value
Superfamily RING/U-box 9.15e-18
Family RING finger domain, C3HC4 0.005
Further Details:      
 
Domain Number 3 Region: 104-157
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000305
Family B-box zinc-binding domain 0.0013
Further Details:      
 
Domain Number 4 Region: 224-280
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 0.0000116
Family Anticodon-binding domain of Class II aaRS 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013356   Gene: ENSTNIG00000010448   Transcript: ENSTNIT00000013549
Sequence length 491
Comment pep:known_by_projection chromosome:TETRAODON8:3:11352792:11354819:1 gene:ENSTNIG00000010448 transcript:ENSTNIT00000013549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPKTGSVARPRAVSSRSGSMLEEELSCPICCEIFKDPVVLKCSHSFCRICLQQFWNKKKA
RRECPVCRRKCSLTEPTDQEKKMGAAEALAGARGSREPLELVDVMCVAHGEVLKLFCLDD
SEALCCVCHTSKKHQGHRVCPLEEGAQDLRAVLKEELIPLKKHLRRLYEAKQECDDTTVH
IKNQTQATEKQIRAAFQELREFLEKEESTRLADLQQESEEKKELVKKKSESISSCILTFS
HAVIAIENEMALNDALFLKSFANTKKRAEIPQKEPEKVSGALVNVAKHVSSLKYHVWEKM
AQLVQYTLSAPITLDPNTAYSWLSLSTDLTSVGNSGTLQQLPDNPERFGHFVFVLGSEGF
ASGRHAWEVEVGDKADWMLGVVRESIDRKGRISGCPEGGFWMISHYEGEYSAMTRPSTTL
HLEGALTRVRVQLDYEAGEVTFSNPVSMTHIYTFHDFFTQRMYPFFCPGANINGNNPKPL
KICPAKVAVWN
Download sequence
Identical sequences H3CYM1
ENSTNIP00000013356 99883.ENSTNIP00000013356 ENSTNIP00000013356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]