SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013379 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013379
Domain Number 1 Region: 33-258
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.6e-47
Family Extended AAA-ATPase domain 0.000000656
Further Details:      
 
Domain Number 2 Region: 264-352
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 3.53e-24
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013379   Gene: ENSTNIG00000010471   Transcript: ENSTNIT00000013573
Sequence length 357
Comment pep:novel chromosome:TETRAODON8:Un_random:9398466:9401175:1 gene:ENSTNIG00000010471 transcript:ENSTNIT00000013573 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAFLKGATVQTTKLQKEKAGAGSSSEKKAKAVPWVEKYRPKCVDEVAFQEEVVAVLKKS
LEGADLPNLLFYGPPGTGKTSTILAAARELYGPVLYRQRVLELNASDERGIQVIREKVKT
FAQLTVAGTRPDGKPCPPFKIIILDEADSMTPPAQAALRRTMEKESRTTRFCLICNYISR
IIEPLTSRCSKFRFKPLDNQVQEERLLAICEKENLKYSGESVSALVRVSEGDLRKAITFL
QSAARLSVDKEISERTITEIAGVVPHKMIDSLLHICFRGTFEKLEVEVRNLVDEGYAATQ
ILSQLHESIIEKDLGDKQKSAITEKMAVVSKCLSDGADEYLQMLSLCSVIMQQSSQH
Download sequence
Identical sequences Q4SDY0
ENSTNIP00000013379 99883.ENSTNIP00000013379 ENSTNIP00000013379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]