SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013382 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013382
Domain Number 1 Region: 107-217
Classification Level Classification E-value
Superfamily Cadherin-like 3e-20
Family Cadherin 0.00016
Further Details:      
 
Domain Number 2 Region: 218-312
Classification Level Classification E-value
Superfamily Cadherin-like 5.85e-17
Family Cadherin 0.00082
Further Details:      
 
Domain Number 3 Region: 337-451
Classification Level Classification E-value
Superfamily Cadherin-like 1.11e-16
Family Cadherin 0.00079
Further Details:      
 
Domain Number 4 Region: 30-114
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000428
Family Cadherin 0.0011
Further Details:      
 
Domain Number 5 Region: 462-544
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000243
Family Cadherin 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013382   Gene: ENSTNIG00000010474   Transcript: ENSTNIT00000013576
Sequence length 775
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:9416873:9423625:-1 gene:ENSTNIG00000010474 transcript:ENSTNIT00000013576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRRRKRAWISPPTKLVENDDYTQKTSIAKIHSDQQAHTKVEYYLTGPGADEPPVNLFVVD
RGTGSVRITGVVDREQYPFFNLTGIAKYTNGTLAETGISLYVTILDINDNAPRFEPQSGE
VFEGSRGGTFVMQIEGKDDDQPGTINSTISYSIISQEPEGLSHMFRIDEQTGKLYVKEPA
LDRERVELYRLVVQGADMAGAAGGLKGSGTVEIRVLDINDNVPTLEQCEYSASVDENVHN
VVVSRIKARDRDLEHTDNWRAVFVIARGNEDNLFAIETDENTNEGVLKLIKPLDFEKVQN
LELTLLIRNVAPFTKGEVVMTDVGVRVRITVNNVVEDPAFIPAVREITVSEDPKDQPKDG
IIMVFTAVDPDTGKAAHVRYAKAFDPGNWFTVDKHTAEIKLNKKPDRESALVVNGRYVAK
IVAISNERPSATATGTIIIRVADANDHCPTLTSTHSSLCADRKTVYITALDEDASPNAAP
FTFTVIPEGSQGSWHVEVINETTAALHSQKNLWPGIYKLQVMLADAQGRSCPAHEEYTLH
VCTCTSWEMCHADRRATSSLKLSAAAIGLLLLPAGLLLLVPLLLLFCQCGGANTIFPDQF
TDLPFQATEHLMAYHTEGKGTDFMWESKMGTAAKRQQSPNAKVIKTDKVSTFYKESAESR
SWKTWEMSNSGFRSHSHRAGAGRTPLFEHIALPEAFLKSYYAQVQYADPSMCPLVQRAAE
AAPVKEGLLDFTFEGQGSSAGSLSCCSLRDPQDDLGFLDDLSTKFKTLAEVCSPA
Download sequence
Identical sequences H3CYP7
99883.ENSTNIP00000013382 ENSTNIP00000013382 ENSTNIP00000013382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]