SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013384 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013384
Domain Number 1 Region: 440-565
Classification Level Classification E-value
Superfamily Cadherin-like 1.96e-24
Family Cadherin 0.00089
Further Details:      
 
Domain Number 2 Region: 236-328
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-20
Family Cadherin 0.0000123
Further Details:      
 
Domain Number 3 Region: 329-445
Classification Level Classification E-value
Superfamily Cadherin-like 1.07e-19
Family Cadherin 0.00026
Further Details:      
 
Domain Number 4 Region: 553-659
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000385
Family Cadherin 0.0066
Further Details:      
 
Domain Number 5 Region: 115-193
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000143
Family Cadherin 0.000031
Further Details:      
 
Domain Number 6 Region: 8-128
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000192
Family Cadherin 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013384   Gene: ENSTNIG00000010476   Transcript: ENSTNIT00000013578
Sequence length 859
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:9447039:9457773:1 gene:ENSTNIG00000010476 transcript:ENSTNIT00000013578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPFPPATFEDCSRGKVRFEVARSSGFRVSDGGEVYTSRRLSLGKDRSVEGLVYAQDLHTK
QVWKARFHLLAKSPQVELGDAGLTQQLPEILFPWRSVIVKGDGTVRRVKRDWVIPVINVP
ENSRGQFPEDLVRIRSDRDKNWMLRYSVTGPGADQPPTGIFIISPISGQLSVTKPLDREH
ISNFQFSAQVIDALAGDLLGPARQIRMALDVCSLSAQRGLGFEQPRNLLASSASFSRSFV
MTVTAVDKDDPKTANGMLRYKILSQNPQSPSPNTFTINNKTGDIITVAAGLDREKVTQYT
LIIQATDMEGNPTYGLSNTATAVVRITDVNDNPPEFTADTFSGEVHENSVNVIVANLTVT
DKDQPHTQAWRAVYRIVAGDPTGRFSIPTDPTTNEGLLTVVKPIDYELTRVFTLLVEAQN
EVPLAHGIHLPRQPTATVSVRVLDVNESPEFSPNPKSIKLEEGLPAGSLLSTFTAQDPDH
FMSQTVRYSKMYDPASWLRIDPFNGRISTIAILDRESPYVRNNQYNVTFVASDDDRPAAS
GTGTLQIYLLDINDNAPHVFPPEVEMCEKPAPNAINITASDPDLGPNAGPFVFELAGRPS
DVRRNWTLSRLNGEYAQLRLQIGSLSSGIYQVPITITDSGNLPLSNTSYLRVKVCPCDHH
GDCVDMERIIAAGLGTGAIIAILICIIILLVLVLLFVMWMKRRDKERQAKQLLIDPEDDV
RDNILKYDEEGGGEEDQDYDLSQLQQPDALESECMKVGVRRLDERPLHHNHQYPLRSAAP
NPGDIGEFIHEGLKAADNDPTAPPYDSLLVFDYEGSGSTAGSLSTLHSSSSCGDQDYDYL
GDWGPRFRKLADLYGGGDD
Download sequence
Identical sequences H3CYP9
ENSTNIP00000013384 ENSTNIP00000013384 99883.ENSTNIP00000013384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]