SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013397 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013397
Domain Number 1 Region: 21-130
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.06e-20
Family Synaptotagmin-like (S variant) 0.023
Further Details:      
 
Domain Number 2 Region: 305-486
Classification Level Classification E-value
Superfamily vWA-like 0.00000000000000149
Family Integrin A (or I) domain 0.021
Further Details:      
 
Domain Number 3 Region: 210-277
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000133
Family Synaptotagmin-like (S variant) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013397   Gene: ENSTNIG00000010488   Transcript: ENSTNIT00000013591
Sequence length 561
Comment pep:known_by_projection chromosome:TETRAODON8:19:5924463:5957288:-1 gene:ENSTNIG00000010488 transcript:ENSTNIT00000013591 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNSFPNMASIGDFDPLNASIPATKVEITVSCRNLLDRDTFSKSDPICVLYTQGMGNREW
REFGRTEVIDNTLNPDFVRKFILDYFFEERQNLRFDLYDVDSKSANLSKHDFLGQAHFSL
GEVVGSLGSRSEKALGGIQGKKCGTIIVKAEELNNCRKKKKLSFFCLFSVDLASVFPFPI
SSLVELNHTCSICRKLKVHCTFLQSLWGFFFFDVRMQCRADVFNRTIKVEVYDWDRDGSH
DFIGEFSTSYRELSRGQSQFNVYEVINPKKKVKKKNYLNSGTVTLLSFLVDVEVTFLDYI
KGGTQINFTVAIDFTASNGNPAQPTSLHYMSPYQLNAYAMALKAVGEIIQDYDSDKMFPA
LGFGAKLPPDGRISHEFALNGNPQNPYCAGIDGVMEAYYQSLKSVQLYGPTNFSPVVNHV
ARYAASVKDGSQYFVLLIITDGISDMAQTKESIVNASCLPMSIIIVGVGPAEFDAMIELD
GDEIRISSRGRYAERDIVQFVPFRDYIDRTGNHILSMARLAKDVLAEIPDQFLSYMRTRG
IKPSPAPPPYTPPGQPLQTQI
Download sequence
Identical sequences H3CYR2
99883.ENSTNIP00000013397 ENSTNIP00000013397 ENSTNIP00000013397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]