SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013398 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013398
Domain Number 1 Region: 3-396
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.5e-117
Family Motor proteins 0.00000115
Further Details:      
 
Domain Number 2 Region: 1279-1570
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.28e-45
Family WD40-repeat 0.00016
Further Details:      
 
Domain Number 3 Region: 949-1070
Classification Level Classification E-value
Superfamily Prefoldin 0.0000000016
Family Prefoldin 0.015
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000013398
Domain Number - Region: 468-548
Classification Level Classification E-value
Superfamily Prefoldin 0.00188
Family Prefoldin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013398   Gene: ENSTNIG00000010489   Transcript: ENSTNIT00000013592
Sequence length 1570
Comment pep:known_by_projection chromosome:TETRAODON8:19:5962994:5973861:-1 gene:ENSTNIG00000010489 transcript:ENSTNIT00000013592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CCIKFVCRIRPQLAKEKIEGCHICTFVMPGEPQVVLGKDKAFTYDHVFDIDTQQESIYQH
CTQRLIEGCFEGYNATIFAYGQTGSGKTYTMGTGFDVNIGDDELGIIPRAVNHLFRGMEE
RRQAATEQGRPVPEFKINAQFLELYNEEVLDLFDTARDPEARKQRSNIKIHEDANGGIYT
VGVTTRTVTSAAEMMQCLKMGALSRTTASTQMNVQSSRSHAIFTIHLCQVRVCAPRQENV
TDNRLANSSDISEFETLTAKFHFVDLAGSERLKRTGATGDRAKEGISITCGLLALGNVIS
ALGDRSKRSTHVPYRDSKLTRLLQDSLGGNSQTMMIACISPSDRDFMETLNTLKYANRAR
NIKNKVMVNQDRASQQISALRTEIARLQMELMEYKTGKRLVGEDGMEGMNDLVHENSMLQ
TENDNLRVRVKAMQETIDAQRARLTQILSDQAYQAMAKAGEGNEEIGNMIQNYIKEIEEL
RAKLLESEAVCENLRKSLSRASTRSSLYGGPGSFSSAMVVPEKEANDVIEMAKRNLEKLK
KIKKKKKRRYNNVILFLKCSVLTERRRPTTNQEQSNEDVAEEGSDHDEGEDAEAEEDEYD
LAGDETSEDSDSEELDEKEDVQADLANITCEIAIKQKLIDELENSQRRLHTLKQQYEQKL
MMLQNKIRDTQLERDKVLHNIGSVESGMEEKAKKIRVEYERKLSSMNKELQKLQSAQREH
ARLLKNQSQYEKQLKKLQMDVTEMKKTKVTLMRQMREQQDRNRAAECRRNREIASLKKDQ
RRAEYQLKQMEAQKRQQELMLRRKNEEVTALRRQVRPVSGTVSRKVTLPESSHKPTQGRM
STPGVTSSNGVRCGNSSCRGSFICLFFIMSEKNSPVRMGSVYLTRTARTKWQSLERRISD
IIMQRLTISNMETDMNRLLRQREDLTKRRERVSRKREKMAAEGADADRTLGSLNEELESL
SANIDYINDSIADCQANIMQMEEGLQEEGDTVDVAAVISSCSLSEARFLLDHLMNMAINK
GLQASQKDSLLKVMEGRLKQTEINSATQNQLLFHMLKEKAEINPELEALLGSALQENGDE
SSSDESTPSPATEGSTLAADLMKLCGESRPRNKARRRAATQMELLYASSGDLSCESPTGD
FPSPLPALPERQEGLSDTQSQASGQTQDREQTSSPSSLTSRPGAVSGARTPTGSERRQME
RSPLSRRKQTPTTTQSAASVSTAAAAAKTSDYQPLLTVIICYRGVINPVMTSKNSGSGKL
HFFYLSYLHTNPFLFLYSTYYLLFTLSKYRTCKVWNLVTGQEIMSLPDHPGSVVSVRYTS
SLVFTVSTAYIKVWDIRDSAKCVRTLTSSGQVGSGDTASSPRGFSVPPGESQINQIALNP
SGSFLYAAAGSAVRMWDLRKFASTGKLTGHMGPVVCLAVDRLGSGQDVVLTGSKDHCIKM
YEVGEGTQGSIGSSHTFDPAHQDGVEALTVHGDVFFSGSRDYHIKKWDLAGKRLLQQSSG
TQSDWPSALGVVPGSSALLGGCRGGLLRLWHADSLAPLGEVRGHDSPINSLAANSNQVFT
ASDDRTVKIW
Download sequence
Identical sequences H3CYR3
99883.ENSTNIP00000013398 ENSTNIP00000013398 ENSTNIP00000013398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]