SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013404 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013404
Domain Number 1 Region: 97-181
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.78e-17
Family Ankyrin repeat 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013404   Gene: ENSTNIG00000010495   Transcript: ENSTNIT00000013598
Sequence length 526
Comment pep:known_by_projection chromosome:TETRAODON8:1:17059604:17069090:-1 gene:ENSTNIG00000010495 transcript:ENSTNIT00000013598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGEKLRALRKDHGPGKDGSLLEPDEEAATGTFTAPKTSSKSRASKIFSNHKLIKSPSTQ
QHNQPAQTEAKTSSLPTAAVPDDSTRTPPIRTGLDFPVHQCVFQGDVRRLSSLIRTQNIA
QKDVHGNTPLHLAVMMGHKECAHLLLAHNAPVKVKNAQGWSPLAEAISYGDRQMITALLR
KLKQQSRENVEEKRPKLLKALRELGDFYLELHWDFQSWAVPLLSRILPSDACKIYKQGLN
IRLDTTLTDFTDMKCQRGDLSFIFNGNAAVAAESFVVLDNEQKVYQRIHHEESEMETEEE
VDILMSSDVYSATLSTKSITFARAQTGWLFREDKTERVGNFLADFYSVNGLVLESRKRRE
HLSEEDILRNKAMMESLSKGGNLIEQNFEPVRRQSLTPPSTNTISWEEYVSADNEKPPHL
GRELVCKESKKNFKATIAMSQDFPLGIESLLNVLEVIAPFKHFNKLREFVQMKLPPGFPV
KLADIPVFPTITATVTFQEFRYDEFDPSMFVIPGDYREDPSRFPDL
Download sequence
Identical sequences H3CYR9
ENSTNIP00000013404 ENSTNIP00000013404 99883.ENSTNIP00000013404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]