SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013445 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013445
Domain Number 1 Region: 199-330
Classification Level Classification E-value
Superfamily PH domain-like 6.39e-40
Family Third domain of FERM 0.00000179
Further Details:      
 
Domain Number 2 Region: 90-198
Classification Level Classification E-value
Superfamily Second domain of FERM 5.1e-35
Family Second domain of FERM 0.00000377
Further Details:      
 
Domain Number 3 Region: 486-573
Classification Level Classification E-value
Superfamily Moesin tail domain 7.45e-31
Family Moesin tail domain 0.0000494
Further Details:      
 
Domain Number 4 Region: 4-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.31e-24
Family First domain of FERM 0.0000536
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013445   Gene: ENSTNIG00000010533   Transcript: ENSTNIT00000013639
Sequence length 573
Comment pep:known_by_projection chromosome:TETRAODON8:10:12211137:12215909:1 gene:ENSTNIG00000010533 transcript:ENSTNIT00000013639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPMQVNVRVTTMDAELEFSFQPSTTGKQLFDQIARTIGLRETWYFGLQYMDTKGTCSWLI
PEKKVMSQDVKKEIPLQLKLRVKFYPEDAAEELIQDVTKRLFFLQVKENILLEDVYCPPE
TAVLLASYAIQVKYGEYDKSKHQQGYLSSERLLPKRVLEQHRLSKEQWEDRIQVWHEEHG
SMLKEEAMTEYLKIAQDLEMYGINYFDIKNKKGTDLWLGVDALGINIYEKQDKLTPKIGF
PWSEIRNVSFNDKKFIIKPLDKKASDFILVVPRLRVNKCIMQMCTGNHELYRRRRSPDTI
EVQQMKSQAQAERLQKKMESAPLPSERSLPAANARPARRDRHLMTKLYEYEETTKRAERE
LQEQLERAMRLEEERRRVEQEAARLETERMEAIIAKEELARQAEDQLRSQEQLAAELAEY
SAKISLLEEAKRSKEEEAESWHSKVAEVEENLMKTKEELQNVRRSESVQPADSESDHEHS
EENSTHSAELQTQDLSNHHLEEERLTEAEKNKQLQDKLKALSSELEQSQYENRKTQNDLL
HAKNIQAGRDKYKTLRQIRQGNTKQRIDEFEAL
Download sequence
Identical sequences H3CYW0
99883.ENSTNIP00000013445 ENSTNIP00000013445 ENSTNIP00000013445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]