SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013454 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013454
Domain Number 1 Region: 32-140
Classification Level Classification E-value
Superfamily TPR-like 3.4e-27
Family Tetratricopeptide repeat (TPR) 0.0034
Further Details:      
 
Domain Number 2 Region: 187-261
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000000019
Family Canonical RBD 0.0064
Further Details:      
 
Domain Number 3 Region: 142-174
Classification Level Classification E-value
Superfamily UBA-like 0.0000306
Family UBA domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013454   Gene: ENSTNIG00000010542   Transcript: ENSTNIT00000013648
Sequence length 301
Comment pep:known_by_projection chromosome:TETRAODON8:10:12292530:12294567:1 gene:ENSTNIG00000010542 transcript:ENSTNIT00000013648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SKAHQEEEVSVKTAEEEAAEEEEIKKRSRELAGIGFRLAATGQYEKAVGFFTDAIKHHPK
EFRLFGNRSLCYERMQQYEKALRDADLALSLEPGWIKGLFRKGKALCGLKRYYQASLVYL
EVMDLDGSSVEARQELKRAQTLHLMEMGFSWAESSKALETHTTMEKAIEWLFDEVLVFLL
SASACRKLFPVWAGVLAPSVTYAMLHQLFSRAGTVYSIKMLLEQQCAFVNYTKEEACVRA
VQGFNGMVVEGAPLTVRYPSPTGVTDPCRSRECFFWRTTGCTRSDCTFKHDPNHKGVDRD
R
Download sequence
Identical sequences H3CYW9
ENSTNIP00000013454 ENSTNIP00000013454 99883.ENSTNIP00000013454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]