SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013481 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013481
Domain Number 1 Region: 152-301
Classification Level Classification E-value
Superfamily EF-hand 1.16e-49
Family Osteonectin 0.00000151
Further Details:      
 
Domain Number 2 Region: 94-149
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000596
Family Ovomucoid domain III-like 0.00033
Further Details:      
 
Domain Number 3 Region: 69-93
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000153
Family Follistatin (FS) module N-terminal domain, FS-N 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013481   Gene: ENSTNIG00000010569   Transcript: ENSTNIT00000013675
Sequence length 303
Comment pep:known_by_projection chromosome:TETRAODON8:18:2959486:2962732:1 gene:ENSTNIG00000010569 transcript:ENSTNIT00000013675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRARCVFLCLLAATFALSVSGNALKGSFSKGKEPAAEMTEDQEKMLNGKEEMEDAEEEAD
TEEELTEEDPCTDFPCKRGKTCKLDGDNKPGCVCQQASECPPSMNDFDRVCGTDNQTYES
SCQLFATKCNLEGTKRGHRLHLDYTGACKLIPPCLDTELVQFPLRMRDWLKNVLLQLYEH
DSSTSSFLTPKQRLKVKKIFESDRRLHAGNHSVELLAQDFEKNYNMYIYPVHWQFAQLDQ
HPSDRSLSHSELAPLRVPLVPMEHCTSRFFQECDADKDKQVSFQEWTACFGIKDEDMDVN
QLF
Download sequence
Identical sequences H3CYZ6
ENSTNIP00000013481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]