SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013502 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013502
Domain Number 1 Region: 18-200
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.91e-29
Family Pentraxin (pentaxin) 0.001
Further Details:      
 
Domain Number 2 Region: 532-818
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000119
Family Rhodopsin-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013502   Gene: ENSTNIG00000010589   Transcript: ENSTNIT00000013696
Sequence length 822
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:23762096:23774523:-1 gene:ENSTNIG00000010589 transcript:ENSTNIT00000013696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IKKYPQKRSMTNTQFSTLTFPMEAHQAFARLNVSLPDLSSISICLRVQWNLDCAKVSTIF
SYAAPVLTNEFQLRGQLDAQGRVLLALIIHGKHLPYKASFANDGAWHHVCVTWCRSSGRW
AIYVDGDRKDAGSEADTSRDISGDGIFILGQDQDSFGGNFTEPFFGNITDLSVWDASLDG
GQVRSLMACEPLTQKELFSWNLEHVSHHPGVQEVEVLLFCPDKTIKRKESPVYLSAALRG
GNQLCCRRESACGGCDPAESYLKMEQQPHEALQPQPGTSARARVLKEGRFLLTDAALVEP
TGGLAQASALLDMSARALGASRQQELQPADMLVLMQLLSVAADTPEPLTSNHSQQDLQEM
SQNFISVADSLISEGSASKWQAIKEVVNGPMDVVRSIDQMVTKLSPHLMEKADHLTIQRA
NIRLAGLPHHYWFPDQLAPGVLGPGVGPGVGTSQEAASESGRYLGTILGSSVISTTVLGD
QQPVSVAVSFQLQHRATVCLFDVSSTIPESGGWWSTKGCQAVSQQPGRTRCSCNHTTNFA
LLLQVYQSQQRSEENEKALQVLTFIGCGVSLCGLLFTFILFIAVGVPKSDRTTVHKNLIV
ALGVAELLLMCSDWVSDSELACFLVTALLHLFFMASFSWMLVEGLLLWSKVVSVNISEDH
RMKLYYVIGWGLPVLIVGVTLAVSVDKYKADEHCWLNVEADTIWAFVGPVVFVLAVNAVV
LCRVVMVTVASARRRAKMLSPSCASKMQTFDLTWAVTRPVLILLPVLGLTWLCGLLVHLS
VVVAYIFITLNAFQGLYIFLVYAVYNSEVRNAIKRIKEKRKA
Download sequence
Identical sequences H3CZ17
ENSTNIP00000013502 ENSTNIP00000013502 99883.ENSTNIP00000013502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]