SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013504 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013504
Domain Number 1 Region: 540-747
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.08e-27
Family Laminin G-like module 0.0048
Further Details:      
 
Domain Number 2 Region: 762-961
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.13e-22
Family Laminin G-like module 0.068
Further Details:      
 
Domain Number 3 Region: 983-1174
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.4e-21
Family Laminin G-like module 0.0079
Further Details:      
 
Domain Number 4 Region: 1350-1392
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000162
Family EGF-type module 0.0034
Further Details:      
 
Domain Number 5 Region: 222-264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000602
Family EGF-type module 0.006
Further Details:      
 
Domain Number 6 Region: 183-225
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000161
Family EGF-type module 0.0036
Further Details:      
 
Domain Number 7 Region: 260-303
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000067
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 8 Region: 1259-1387
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000785
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 9 Region: 337-379
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000343
Family EGF-type module 0.0039
Further Details:      
 
Domain Number 10 Region: 1199-1238
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000025
Family EGF-type module 0.0067
Further Details:      
 
Domain Number 11 Region: 298-341
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000328
Family EGF-type module 0.0033
Further Details:      
 
Domain Number 12 Region: 434-467
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000921
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 13 Region: 31-70
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000902
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 14 Region: 147-188
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000012
Family EGF-type module 0.013
Further Details:      
 
Domain Number 15 Region: 473-503
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000286
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 16 Region: 375-439
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000895
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 17 Region: 108-143
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000201
Family EGF-type module 0.013
Further Details:      
 
Domain Number 18 Region: 73-118
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000254
Family EGF-type module 0.029
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000013504
Domain Number - Region: 963-1014
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000135
Family EGF-type module 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013504   Gene: ENSTNIG00000010591   Transcript: ENSTNIT00000013698
Sequence length 1461
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:23896052:23909832:-1 gene:ENSTNIG00000010591 transcript:ENSTNIT00000013698 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLGGVLLRCPRTLLITVMMFKLGLLCTAAADTCLSSPCRNGATCLDNLDDYVCLCPKGP
VWFMGRNCEELLDACITAPCANCTSIPGSGQFSCHCPDGFTGLNCTEDVDECQGKPCDGV
RSLCVNRENGYSCHCPLGLGGAACLDNVTTCSEVSCQNGGTCVDVTGFWCQCAAGYQGDV
CETDVDECQSEPCQNGAICRDGVNGYQCYCVPGFQGYRCDLDINECASHPCQNNGTCVDQ
VDHYSCECAAGFRGTNCQAEIDECEERPCQNGATCQDHVAAYSCLCVTGFQGPDCELNID
ECASTPCLNEGRCIDGVNSYQCDCEDTGFIGDHCEEDIPECASNPCQHGATCLEGIKQYR
CQCWPGYQGDHCQVDVDECEQNPCENSGRCFQRSDVLVYGTLPQLNQTSFQYAAAAGFIC
SCLPGFTGDNCSVNVDECASAPCQHGGSCQDGVNSYQCVCADGFTGARTARVDVNECDSN
PCQNGATCSDAANFYTCRCPAPEPGEEPWGGDCEVRLVGVPPARCQHSTGCIPLLRDSGE
QGYSCVCSPGWAGDLCNTSTTFSFSSEGFVHVQMPLPPNRTRTEARDHVHGLHMQLRFRS
TLPNMLLFRRGTVEHYASLELVEGSLLAKVRSGRVLQVVYPGPLNDGEWHQVTMSMDESL
VLAVRGPTCEEECQVKNEGHNYLIFLQPSSFQQLYVGGAPWEYLSRTASNKSFIGCMEDL
RVDHKLLLPQDLLREESQGLELGCNKRDWCGGEPCMQRGHCVDMWVRARCVCRRPYYGDQ
CEKEFPSWTFGHENTTSYAAFHISESHGENFTLSFSMRSLKRSGLLLQLHRQGTPYLTLY
LKNGSVAIYSPHTTLISEVKAVTDGNNNSVEIKVQYGHVIFPKAGNNRALGNVSVEAGDV
AYVGGLPAANSMNAWGGNFKGCLQDIRLDDKHLAIGDHPEGVHVYQASAAENVIPGCQSD
NSCKDEPCLNNGSCQITWNDFNCSCPADFSGRLCETRLWCVNRPCFHGAHCVDLPDGYEC
LTDAMFQDNALEFVANGSLQSPVTNITMAIRTRDPNGTLLRASSAAEVFCLGLLNSSLLV
KMDSGENAQLLAFTSDGVIADGAWHHIQLTMVSPVHSSSRWRLTVDGQRVGDSFGIGGHL
NFLNDTKMWLAEKYTGCIGEVRVGGVYLPLMDVPDAPQMTKFSRLGGEEPTVGCRGSPVC
DSQPCRNMGVCHDQFNEFNCSCRAGWEGKVCETEINECSSGPCVFGTCEDLQADYRCHCE
PGYAGRNCQDEVDDCLEFSCVNGGLCVESEGAHTCSCPPGFIGKRCQWRFPPVSCTVNTD
CLNGGVCVGGESGGNCTCKQGYTGARCETEIDECESNPCLNGATCLDRLNHFQCECVPGF
SGTLCENNKDEHRERVPWLVVAIPLTTLCMLLAILVVFFLIMTARKKRQSEGTYSPSSQE
VAGARLEMGSVLKVPPEERLI
Download sequence
Identical sequences H3CZ19
99883.ENSTNIP00000013504 ENSTNIP00000013504 ENSTNIP00000013504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]