SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013510 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013510
Domain Number 1 Region: 1463-1686
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 9.68e-81
Family Fibrinogen C-terminal domain-like 0.00000249
Further Details:      
 
Domain Number 2 Region: 840-1017
Classification Level Classification E-value
Superfamily Fibronectin type III 9.53e-22
Family Fibronectin type III 0.00044
Further Details:      
 
Domain Number 3 Region: 1200-1289
Classification Level Classification E-value
Superfamily Fibronectin type III 1.27e-20
Family Fibronectin type III 0.0000909
Further Details:      
 
Domain Number 4 Region: 1292-1451
Classification Level Classification E-value
Superfamily Fibronectin type III 1.11e-19
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 5 Region: 571-748
Classification Level Classification E-value
Superfamily Fibronectin type III 2.01e-16
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 6 Region: 747-837
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000341
Family Fibronectin type III 0.0000732
Further Details:      
 
Domain Number 7 Region: 1023-1109
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000286
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 8 Region: 1114-1200
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000503
Family Fibronectin type III 0.002
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000013510
Domain Number - Region: 327-351
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000206
Family EGF-type module 0.062
Further Details:      
 
Domain Number - Region: 483-507
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000282
Family EGF-type module 0.059
Further Details:      
 
Domain Number - Region: 513-537
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0019
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 420-445
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00297
Family EGF-type module 0.049
Further Details:      
 
Domain Number - Region: 390-413
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00327
Family EGF-type module 0.061
Further Details:      
 
Domain Number - Region: 545-568
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00609
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 358-383
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00624
Family Integrin beta EGF-like domains 0.058
Further Details:      
 
Domain Number - Region: 265-289
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0152
Family Integrin beta EGF-like domains 0.079
Further Details:      
 
Domain Number - Region: 451-475
Classification Level Classification E-value
Superfamily EGF/Laminin 0.016
Family EGF-type module 0.049
Further Details:      
 
Domain Number - Region: 235-259
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0168
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 204-228
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0206
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 297-320
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0244
Family EGF-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013510   Gene: ENSTNIG00000010597   Transcript: ENSTNIT00000013704
Sequence length 1693
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:23981397:23997800:1 gene:ENSTNIG00000010597 transcript:ENSTNIT00000013704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTKTILLVCLSVSLLFQLSAAGLVRKIIRHRRETLMPKKSQENLTLPHPDQPVVFNHVY
NINVPSTSLCSVDLDLPGEPEVKHKTPLRGVQNMEHIEHTEDGDNQIVFTHRITIPKQAC
SCENQLLDVKSILNRLEMLELELSSLREQCSGGAGCCGAQVAGEISTKPYCNGRGNWSSD
TCSCLCEVGWKGQNCSEPDCPGDCQDQGRCLNGRCECFEGFGGDDCSAELCLLDCGDYGH
CVSGVCLCEEGFSGQDCSQTNCLNSCLGRGRCLEDECVCDEPWTGLDCSELICPNDCYDR
GRCLNGTCECEQGYAGEDCGDLSCPGLCSNRGVCLNGQCVCQSGYSGDDCSKLTCPKNCN
EKGHCFNGKCICDPGREGEDCSVLSCPDNCNDRGQCVDGACVCDAGYQGEDCGALSCPNN
CLDRGNCVNGQCVCDKGYSGEDCSVKTCPKKCMERGDCVDGKCMCFPGFKGKDCGEMTCP
GDCSNQGRCESGKCVCHKGYTGEDCSLKTCPKNCHDRGYCIDGNCVCYEGFTGPDCSTLA
CPSDCQNQGHCKNGVCVCEEGFIGEDCSQVSPPKDLTVVEVTPETVDLSWDNEMRVSEYL
VKYVPTAPGGLELDMQVPGDQKKATILELEPGVEYLIRVYAVLNNKKSIPVDARVALDLP
KPDGLKFKSVRDTSVEVEWDPLDIPFDGWNLIFRNTKEEDGEILNSLGQPETTFEQSGLG
PGQEYEVKLEVVKNNKRGPPASKSVITMIDSPNQVDIRDVTDTTALLTWLPPVAEVEEVS
ISYGPSSNPADRNVVELPSTESQYHLGGLDPDTHYQVSLTAHKGDWSSKPVHESFLTELD
APKNLKTAEITDESITLEWENSRAQVDNYRIKYGPLSGGEHRELLFTPGAKDHTHAKITG
LRASTEYGMGVTAVKDERESLPTTTNAVTALDSPKDLTVTKVTETTMLLEWRHPQAKLDS
YRLVYVSADGHRREEVLPGDLKSYSLVDLSPGTLYTISISAERGSRTSAPNTVSAFTEEE
KPLVTSFTISDVSWDSLQLSWEAPDGAFQAFLVKVTDAETGSEVQNHSVVAGARSFAISD
LSATTWYRVSLYGLHRGALLGPVTADTITEAEPEIQALLVSAVTPGSFRLTWTAEEDALD
TFVIMVSPADDPGHPTELVLASEQRSVAVTNLTEDTQYKIQMFGLRFGRRTKSVQESVRT
DLAPPKGIRFSDVTDTSTTVHWGAPRVRVDSYQITYVPAHGGSAKTLTVDGSKSQTVLPN
LTPGVTYEVTIVAVKGSRESLPASDSITTALDKPRGLVAVNITDTGALLLWQPAIATIDG
YVITYSADAVDPVMERVSGNVMEFQMSSLVPATRYTVKVFAARDLAKSAATSTEFTTDVD
TPTHLAASSIQTESAMLTWKAPRASITGYILSFEAVDGTVREVVLSPTAVSYNMAQLSAS
TEYSVRLQAIAGPKRSRVVAAVFTTTGVQYRHPRDCSQVLLNGDGASGPYTIFLGGDENQ
PLQVYCDMSTDGGGWIVFLRRQSGKLDFFRNWKNYTSGFGDMNDEFWLGLSNLNKITAAA
QYELRVDLRDKGETAFAQYDRFSVSEPRSRYKVHVGGYSGTAGDSMTYHHGRPFSTYDHD
NDIAVTNCALSYKGAFWYKNCHRVNLMGRYGDNSHSKGVNWFHWKGHEHSIEFAEMKLRP
SNFRNLEGRRKRS
Download sequence
Identical sequences H3CZ25
ENSTNIP00000013510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]