SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013567 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013567
Domain Number 1 Region: 3923-4294
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 3.31e-101
Family Regulator of chromosome condensation RCC1 0.0015
Further Details:      
 
Domain Number 2 Region: 2926-3294
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.13e-100
Family Regulator of chromosome condensation RCC1 0.0015
Further Details:      
 
Domain Number 3 Region: 4431-4762
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.7e-90
Family Hect, E3 ligase catalytic domain 0.0000309
Further Details:      
 
Domain Number 4 Region: 419-775
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 5.32e-86
Family Regulator of chromosome condensation RCC1 0.0038
Further Details:      
 
Domain Number 5 Region: 2697-2879
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.17e-31
Family APC10-like 0.008
Further Details:      
 
Domain Number 6 Region: 2522-2599
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.32e-29
Family CPH domain 0.00065
Further Details:      
 
Domain Number 7 Region: 1823-1890
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 8.11e-21
Family Mib/herc2 domain 0.00017
Further Details:      
 
Domain Number 8 Region: 1199-1283
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 0.0000000000000131
Family Cytochrome b5 0.0086
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000013567
Domain Number - Region: 2416-2472
Classification Level Classification E-value
Superfamily UBA-like 0.000113
Family UBA domain 0.012
Further Details:      
 
Domain Number - Region: 3591-3677
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00335
Family Spermadhesin, CUB domain 0.0075
Further Details:      
 
Domain Number - Region: 2448-2500
Classification Level Classification E-value
Superfamily BRK domain-like 0.0379
Family BRK domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013567   Gene: ENSTNIG00000010652   Transcript: ENSTNIT00000013761
Sequence length 4808
Comment pep:known_by_projection chromosome:TETRAODON8:1:10936785:10968831:-1 gene:ENSTNIG00000010652 transcript:ENSTNIT00000013761 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSPSFTLDAQLRFHDKWLKIDLQRAFSPQGLSEMWNEMVIDEEITFNREESAHTGTALH
LQNPTHGAQNSGSKKDEPNDKEKKEDEDMLTSAHHSIIETWDWGRQPDESELKECLAVLV
EDQQKLSGFLAKSTLSAQRLRQRLVILERYLISLTHSMLEEKYKIRYKSPPSPPLPTTDN
KSSRPVSKGVEGLARVGSRAALSFAFAFLRRAWRSGDDADLCSELLQESLDALRALPEAT
LFDEGTVSSVWLEVVERATKFLRFSSDIHGSGSTKGNIPLQDQHLALAILLELAVQRGTL
SQLMSAVLLLLRLWESGTREMDNERSTQGTSAPLLPLLQRFQNIHSSKEEPVTEEEAEIL
TAPLSPNEGFLRYLILPQDNDLAIDLRQTAVVIMAHLDRLASPYSPPNCNSPTSHKGTLQ
EVIAWGLLGWKLYANVNGPIHCKSLSSLGVTQIVCSEKGFLILSSSGAVYTQNYKSTTLA
PMLIHSLSSRKMVKLAAHPDGQHYLALSSNGEVFSWGCGDGGRLGHGDTTYLEEPTMIAA
FNGKQAGKHVVHIACGSTYSAAITVDGELYTWGRGNYGRLGHGSSEDQTTPMLVTALKGL
KVVDVACGSGDAQTLAVTENGQVWSWGDGDYGKLGRGGSDGCKTPKLVEKLQDLDIVKVC
CGSQFSVALTKDGQVYTWGKGDNQRLGHGTDEHVRFPKLLDTLQGKKVVDVAVGSTHCLA
LTDDGEVHSWGSNDKLQHFDTLFSNKKQPKALPGLNSKHIVGISCGPGQSFAWSSCSEWS
VGLRVPFVVDVCPMTFEQLDLLLRQVSEGMDGSSDWPPPQEKECMVVATLNLLRLQLHAA
ISNQVDPDRLGLGLGSVLLNNLKQTIVVLASNAGVLNTVQAAAQAVLQSGWSVLLPTAEE
RARALSSLLPNTALGNEMSVIPGRRNMNSLMVDGGLDSALNAAITADGEDIEAKKEAQKE
KEIDEQEANASTMHRCRTMLDKDLINTGIYESAGKQSLPLVQLVQQLLRNIASQTIARLK
DVARRISNYLEAENVNKERSASLDLLLRFQRLLVSKLYMRASGTENVNGYNPELLGVGSL
LKKYIALLCTHIGDILPVATSIASTGCRHFAEVSRVIEGDLTGVLLPELVVSIILLLTID
AGLMQETGSIPLLAGLLEHLDRFNHLAPGHERDDNEDLAWPGIMGSFFAGQSSKNNEEVS
LIRKADLENHNKDGGFWTVIDGKVYDIKDFQAQSLTGNSILAQFAGEDPVVALEAALQFE
DTRESMQSFCVGQYMEPNQETVTTPDLNSLSSPLIDTERNLGLLLGLHASYLAKSTPLSP
MEIECAKWLQSPIFSGGLQTSQIHYNYNEEKDEDHCSSLGTTTPDKAKLYSQRITLSDHA
QPFLQAIADNTTQDHTVKDFLCQIERSCKQYHLITPITFPPEHPVEEVGRLLLCCLLKHQ
DLGHIALSLVSQCALGLDQGKQRSLPKSVIDVCRMVYQAKCSLIKTHQEQGRSYKEVCAP
VIERLRFLFNELRPAVSNDLSIVSKLKLLSSQPRWRRITQKLIRDRRKKRVPKKSESADI
EEPKVENEGTIEEELNVHISPTPVERKSPTSKISKDKWHPLLNTVTNVQKYRWLKHNVSG
TFFHCSXEVIPERTSIGKSTKLDLTELKFVFMMCVVNVWPCIILPCREPLFDCLKDVDLI
PPFNRMLLEVTFGKLYSWAVHNIRNILLEASARFKELGVQPVPLQTITNENPAGPSLGTI
PQARFLLSMIHMLSLKHVSNSLSLLLNSGILALTQSILRLIGPSTDSTEEDLSLCGLGGS
ATVLEESRKETTPAPLPASGPELAAMMKIGTRVMRGVDWKWGDQDGPAPGLGRVIGELGE
DGWIRVQWDTSSTNSYRMGKEGKYDLKLAEPPPPAQPPTEDSDTEDDTEAELMEKSSHPT
AMMLTSTVNLLKTLSLSSGIYAEVLQTDATRTLCGLLRMLVESGANDKGSHTHRLVSREQ
HRSWCTLGFIRSIALMPQMCSTLSTSAWISLLIRIVEGHQSFNAITLQRQILALRLLQAV
LPSWDKIERCHDMKFLVEKLFCFLGSLLSTCSSDLPLLREGSLRKRKSRPQASLTATHSS
TLAEEIVSVLRILHSLGQWNSLINDYINAQLSSIGDVMAGCQSEACLLEEYFPDSEGFRV
GSVMAVLAVIGGIDGRLRLGGQVIHEEYGEGTVTRITPKGRITVQFHEMRTCRVCLLSHL
KPLPAVNFSVQNLPFTEPMLGVWAQLVSLAGSKLEKQRMKKSASRGLTADQVDLHLLRCQ
QLRLYILKAARALLSHQDTLRQILCQPAVVDIAPNTGGMSSSKDQVATSPDVGDLSPEGP
LPPMILLQQLLSAATQPSPIKAIFDRQEMEAAALAVCQYLALESAHPSSPLFEESSSSEA
TTPITIPHIRPPKQKKQKTSPVPPLPIVIQLMEMGFPRKNIEFALKSLSGTTSSASGVPG
VESLVGWLLDHPDVHVAELSDADTVSDEYSEEEVLEEMEETEPTFPVASGAVVTESQTYK
KRSDFQTNDDYAVYVRENIQVGMMVKCCRTYEEVYDGDIGKVIKLDRDGLHDLNVQCDWQ
QKGGTYWVRYIHIELLGFPPQSSLSHIKIGDKVRVKPAVTTPKYKWGSVTHRSVGVVKAF
SANGKDVIVDFPQQSHWTGLLSEMELVPSIHPGVRCDGCQMFPINGARFKCRNCDDFDFC
ENCFKTRKHNPRHSFGRINEPGQSSAFCGRSGKQLKKHHSSQRGMLIDEWSRAVKSLNVS
SSIHQASRLIDCSDQCWQSSGSQGKHWIRLEIFPDVLVHRLKMTVDPADSSYMPSLVVVS
GGSSLNNLIELKTININPTDTNALLLNDCTEYHRYIEIAIKQCRSSGIDCKVHGLSIIGR
IRAEDEDLATVPFLASDNEEEDDDKAATGSLARKKSSGLESAGTIRTKVFVWGLNDKDQL
GGLKGSKIKVPSFSETLSALNVVQVAGGSKSLFAVTVEGKIYACGEATNGRLGLGLSSGT
IPIPRQITALSNYVVKKVAVHSGGRHAMALTVDGKVFSWGEGDDGKLGHFSRMNCDKPRL
IEALKAKRIRDIACGSSHSAAITSSGELYSWGLGEYGRLGHGDNTTQLRPKLVKVLLGHR
VIQVACGSRDAQTLALTDEGLVFSWGDGDFGKLGRGGSEGCNIPQNIERLNGQGVCQIEC
GAQFSLALTKSGVVWTWGKGDYFRLGHGTDVHVRKPQMVEGLRGKKIVHVAVGALHCLAV
TDTGQVYAWGDNDHGQQGNGTTTVNRKPTLVQGLEGQKITRVACGSSHSVAWTTVDVTTP
SVHEPVLFQTARDSLGASYLGVQSDSDSSAVNNKMSGQSSTKPNRPSLAKILLSLDGNLA
KQQALSHVLSALQIMYARDAVVDALMPASMILPAERPSSSPLPPSESSSSSSVSDEEGPP
IPPDAEERVNPSLWQDKKGEEQVPSSEEAVTPSSAMTPSASGTSSRPFIPVTDDPGAASI
IAETMTKTKEDSESQSKVIGPEPQYLDEFTSLLVPDDTRVMVDLLKLAVSCRSGEKGREV
LSAVLSGMGTAYPQVADMLLELCVTELEDVATDSQSGRLSSQPVVVESSHPYTDDTSTSG
TVKIPGAEGLRIEFDRQCSTERRHDPLTIMDGANRIVSVRSGREWSDWSSELRIPGDELK
WKFTSDGSVNGWGWRFTVYPIMPAAGPKDLLSDRCILSCPSMDLVTCLLDFRLNFASNRS
IVPRLAASLAACAQLSALAAGHRMWALQRLRKLLTTEYGQSININRLLGETESETRSVSF
TGSALAALVKGLPEALQRQYEYEDPIVRGGKQLLHSPFFKVLVALACDLELDTLPCCAET
HKWAWFRRYCTASRVAIALDKRSSLPRPFLEEEGYKAKFAELMADHESMNSLHESHDLFK
REHDEQLVQWMNRRPDDWTLSAGGSGTIYGWGHNHRGQLGGIEGAKVKVPTPTEALATLR
PVQLIGGEQTLFAVTADGKLYATGYGAGGRLGIGGTESVSTPTLLESIQHVFIRKVAVNS
GGKHCLALSSEGEVYSWGEAEDGKLGHGNRSPCDRPRVIESLRGVEVVDIAAGGAHSACI
TASGELFTWGKGRYGRLGHGDSEDQLKPKLVDALQGHRVIDVACGSGDAQTLCLTDDDMV
WSWGDGDYGKLGRGGSDGCKTPMKIDSLTGLGVIKVECGSQFSVALTKSGAVYTWGKGDY
HRLGHGSDDHVRRPRQVQGLQGKKVIAIATGSLHCVCCTEDGEVYTWGDNDEGQLGDGTT
NAIQRPRLVAALQGKKINRVACGSAHTLSWSTSKPTNAGKLPAQVPMEYNHLQEISIMAL
RNRLLLLHHISELFCPCIPMFDLEGRLGQTGHGPSVGFDTLRGILISQGKEAAFRKVVQA
TMVRDRQHGPVVELNRIQVKRSRSKGGLAGPDGTKSVFGQMCAKMSSFSPDSLLLPHRVW
KVKFVGESVDDCGGGYSESIAEMCEELQNGLTPLLIVTPNGRDESGANRDCFLLNPAAKS
PLHMSMFRFLGVLLGIAIRTGSPLSLNLAEPVWKQLAGMNLTIADLSEVDKDFIPSLMYI
RDNEATAEEFEAMTLPFTVPNASGQDIQLSSKYSHITLENRAEYVRLAINYRLHEFDEQV
SAVREGMARVVPVPLLSLFTGYELETMVCGSPDIPLHLLKSVATYKGVEPTSALIQWFWE
VMESFSNTERSLFLRFVWGRTRLPRTIADFRGRDFVVQVLDKYNPPDHFLPESYTCFFLL
KLPRYSCKQVLEEKLKYAIHFCKSIDTDDYARIALSGEPAADDSSEDSDNEDADSFASDS
TQDYLTGH
Download sequence
Identical sequences H3CZ82
99883.ENSTNIP00000013567 ENSTNIP00000013567 ENSTNIP00000013567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]