SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013588 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013588
Domain Number 1 Region: 23-94
Classification Level Classification E-value
Superfamily UBA-like 4.88e-26
Family UBA domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013588   Gene: ENSTNIG00000010673   Transcript: ENSTNIT00000013782
Sequence length 129
Comment pep:known_by_projection chromosome:TETRAODON8:11:1639712:1640248:-1 gene:ENSTNIG00000010673 transcript:ENSTNIT00000013782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSSLGNDKAQGPREKALAPATHTPQPQKQIQATAEQIRLAQVIYDKSDADFEDKVNQLM
EVTGKNQDECMVALHDCNEDVGRAINFLLESTSDMVNNIPATSYLRQLTAGNEEILMLQT
GLVAASSWF
Download sequence
Identical sequences H3CZA3
99883.ENSTNIP00000013588 ENSTNIP00000013588 ENSTNIP00000013588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]