SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013604 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013604
Domain Number 1 Region: 59-526
Classification Level Classification E-value
Superfamily Sema domain 3.4e-142
Family Sema domain 0.000000177
Further Details:      
 
Domain Number 2 Region: 522-554
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000134
Family Plexin repeat 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013604   Gene: ENSTNIG00000010688   Transcript: ENSTNIT00000013798
Sequence length 705
Comment pep:known_by_projection chromosome:TETRAODON8:1:14563299:14600410:-1 gene:ENSTNIG00000010688 transcript:ENSTNIT00000013798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSNPRAAVTTMTPPGFFLLVWLLRTVISAFPEEPGPLNFIPTEVVRRHPVFLGRPHRTWL
RQEPLHIQRILQVNRTLYIGARDDLFRVELDNVAGDEMFYSKKRTWESNKNDIRICRMKG
KHEDECRNFMKVLLSRRGGLFVCGTNAFNPLCANYTVRDTLEMIRDPVSGMARCPYDPKH
ANVALFAEGNLFTATVTDFLAIDAVIYRSLGDSPALRTVKHDSKWFREPYFVSAVEWGPH
IYFFFREIAMEFNYLEKVVVSRVARVCKRDRGGSQRVLEKQWTSFLKARLNCSVPGDSHF
YFNLLHSTSPIIRMHGRDIILGVFSTPANSIPGSAVCAFDMEQLAGVFDGRFKEQKSPES
IWTPVADEAIPKPRPGGCAVQGSRFNSSNSFPDEMLNFVKTHPLMDEAVPSLGQRPWIVR
TMVRYQLNKIVVDTEAGPHRNRTVVFLGSSRGTILKFLIMPNQDNTVTNSNIFLEELEGF
NPDKCVEDSPQARQLLSLTLDRVSHSLLLAFPSCVVSVPVARCQLYSRCMKSCIASRDPY
CGWTRGSTCSFLRPGTRLPFEQDVVKPWRGIVVAGIVVAGLLLQESFIDEPDGLVSVNLL
VVSAVSAFATGAVLSGLTVCWIMSHRHRHSRGSASSSARRKSDKEHSMLGQGCSGSVMSV
TRTSGGERRRSQADNPFVTPNGWPKGEMDPGLLPTPEQTPLQQKR
Download sequence
Identical sequences H3CZB9
ENSTNIP00000013604 ENSTNIP00000013604 99883.ENSTNIP00000013604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]