SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013625 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013625
Domain Number 1 Region: 898-1187
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 6.87e-83
Family Complement components 0.0000162
Further Details:      
 
Domain Number 2 Region: 1273-1390
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 8.89e-26
Family Alpha-macroglobulin receptor domain 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000013625
Domain Number - Region: 736-790
Classification Level Classification E-value
Superfamily E set domains 0.00014
Family SVA-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013625   Gene: ENSTNIG00000010707   Transcript: ENSTNIT00000013819
Sequence length 1391
Comment pep:known_by_projection chromosome:TETRAODON8:14:9785958:9793650:-1 gene:ENSTNIG00000010707 transcript:ENSTNIT00000013819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QRHTQVLSRKHLGVCGGVILTLLFCFCSQEHPASYLLLAPGSLQPGLQTTLSVTILGSSP
VLVSAGITHQNQMVAMNSVTVEGVCFSRGHVSMLGEIQRDESSHRSPYLLHVKGHVNEVE
VFSNETELTFDPKCFSTFIQTDKPNYRPGQAVRMRVVSLGPDGRPNHSPVNVTVRDPRGN
LLRQWLAVDGVHGVVSKEFQLSENPPVGQWSIVARVSDAVTEKHFSVAKDASPTFSVHIQ
APKRVHRDQVLQGSVQAKYVYGKPVRGHVNLTFIYPPRWRLTSTFLSLLQIDGTADFTFD
LLGYRHVEKSHLGMAFYDGNVDDESVTVLVHVTDQLTGLTCNSRTTVFVATSRYDLCFEG
HPKMLKPSLSFVAMLKVSTYNKQPLSLEDRQKPVRVSVKQQKQQGWMEGVEEEEEMVAEE
MELHVPADGIIPLSITLKNDTGILLIEAYFGDSHHSLQLYRGYSSPSHSYLQIQRPPTPA
QVGSPVTLNIQSNFPVFQIRYLVKAGGQVVSAGAGAAPLSLLPEASWAPLACVLVYCLHP
TGEVVNDQIELPVTPVTNNKVSLSWSRSVVEPGDQVVLRVTAEEPASLVGVLVVDKATQR
GGSHNDLTLDSMLHKPELLDAYPIFQMGDPYSVFKTCDLVAMTDAMLQVPEHLLYLDALA
EEELLHHQDEGSAMEEDEHLQEHFPETWIWKDVHTGHSVSSDIQVTVPDSLTTWVVSAFV
VSENLGLGFAEAPVELTVLKDFFLSLNLPACVIRGEELLLEVVVFNYLPHQVEVTVTVAE
SHMFQFVFSDQGGLATPFVTHLFVESQGEASVHIPIRPLVLGEVPVSVEAKTSTASDSMV
RTVVVKAEGLEQFFSSSLLLELSSQSSLAEHLSFSFPPDVVMGSQRASVTVVGDLLGPSI
SGLDHLIRMPHGCGEQNMINFAPNVYVLQYLSATGQADPETTARATAYMSTGYEQELTYQ
RADGSFSAFGDSDAAGSTWLSAFVLRCFLQARPFIGVDAQVLEGVAAWLSTQQGAGGRFE
ESGRVIHTELKGGLEGPVSLTAYVLIALMEDPDLSVSGALGFLETRLDLGISSNYSLSLV
AYALALANSSRAPLALQELMGRAELKDGVPLWSSPEAGRSRSSWQPRSADIEMASYVLLS
HHKLGLIAEGVKLMKWLSQQRNDRGGFRGTQDTVVALQALATLAALTSSHDIDLTVRVNT
DEWVAAAVFHVDQDNYLLHQSQQIEAGEGLHLQVTAEGWGLALFQLNVFYNVWRVEPTRK
RRDSQEPGAEPEAFRLSVELFDSDSHPAHLSICLSLVQGLALSATGMAIVEAGLLSGFVL
PPDGIQTDDVVRKVETPPGKVIVYLDSVTTSEVCLSIPLMVQNKVAKVQEASVLVYDYYE
STRRATQTYNS
Download sequence
Identical sequences H3CZE0
ENSTNIP00000013625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]