SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013667 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013667
Domain Number 1 Region: 836-1165
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.43e-106
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000018
Further Details:      
 
Domain Number 2 Region: 1125-1423
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.04e-79
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000129
Further Details:      
 
Domain Number 3 Region: 359-546
Classification Level Classification E-value
Superfamily Fibronectin type III 6.16e-25
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 4 Region: 2-162
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-22
Family MAM domain 0.0000402
Further Details:      
 
Domain Number 5 Region: 289-388
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000571
Family Fibronectin type III 0.0089
Further Details:      
 
Domain Number 6 Region: 515-612
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000726
Family Fibronectin type III 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013667   Gene: ENSTNIG00000010747   Transcript: ENSTNIT00000013861
Sequence length 1425
Comment pep:known_by_projection chromosome:TETRAODON8:14:4487479:4523144:-1 gene:ENSTNIG00000010747 transcript:ENSTNIT00000013861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGSCSFDEGFSTCNYQHDLNGDFDWTHINTKAVPYVSPDLPQALFEYVKDRNMSQGKASS
LLLNQVCARSDAHILCASVLIIKSDGSGQGVQSNVMVKVNRAQPANPIWNVTSFTGKNWL
KAELAVSTFWPNEYQVLFEASVSKSKAGFIAIDNVQVLSYPCGPLPSLPLHLLSPEISLC
CKRKKITPHVQLWSEEVFEKELVLALHCDSIHSSSCSSARTLVCEVTSQDQDLFRCVTQS
ELGSGVSNFAHLFVKGPDKPFTIDDLFCFSVSYISNWKIGQTIIKLGSIIFLHVAYRMTS
GSWTETHAVNTVTYKLWHLDPDTEYEIRVLLTRPGEGGTGKPGPPLITRTKCAEPMRTPK
RLKIARTMSRLIAVDWESLGYNITRCHTFNVTICYQYTTANKIFLFNKFFSTAPRHLVEN
LPPYTNVSLKLILINPEGRKESDDTIVQTDEDVPGPVPSQSLRAFPSEDSILLYWKKPSE
PNGIIIQYEISYCGLHSFDPSFPLDQSVLTVSLPSNATNHTFSQLHPGVTYELSIRASTS
KGFGQAVTLNITTNISAPTIEKYDGSEAFLNETETTITVLVKPAQAKGAPISNYYIVVDK
ENQQRRRRQAPSDCYTVPFSYSDASKSGSNYYFAANLCPENILEPIPFTVGDNKTYQGFW
NPPLALRKTYNIYLQAVSSTTKESKRHCLKLASKGATEEPNFVPDPAKQTNPTMKITGIC
LSVIVPILLVALTVFLVKKSNRKLARKRQDVIRTTGQEMTDLGNSTDRSYAERSTLHRED
PMAVTFVETHTYNNRYENHGGSAAENSHLLDIARYHCEGTESPYQTGQLHPAIRVADLLQ
HINLMKTSDSYGFKEEYESLFEGQSASWDVAKKEQNRTKNRYGNIIAYDHSRVILQPIEN
DPSSDYINANYIDGYQRPSHYIATQGPVHETVYDFWRMVWQEQSACIVMVTNLVEVGRVS
RFTENTPTNGSVRCSGWVKCFKYWPEDAELYGDFKVTYLETEHLAEYVVRTFTLERRGFN
EMREVKQFHFTGWPDHGVPYHATGLLSFIRRVKISNPPSAGPIVVHCSAGAGRTGCFIVI
DIMLDMAEREGVVDIYNCVKALRSRRINMVQTEEQYIFIHDAILEACLCGETAISICEFK
AAFYELIRIDSQTNSSHLKDEFQTLNSVTPQPQPEDCSIALLPRNQDKNRFMSGLPPDRC
LPFLLTMDGESSNYINAALMDSYRQPAEFIVTQHPLPNTVKDFWRLVYDYGCASLVMLNE
IDLAQGCPQYWPEEGMLCYGHMQVDCISSSMDCDIISRLFRVHNVTRPQEGYLMVRQFQY
LGWAGHRDVPASKRSFLKLILQVDQWQREVEEEGEGRTIVHCLNGGGRSGVFCASSIVCE
MSKRQSVVDIFHAVKTLRNSKPNMVDTPEQYRFCYDLALEFIESS
Download sequence
Identical sequences H3CZI1
ENSTNIP00000013667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]