SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013691 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013691
Domain Number 1 Region: 242-361
Classification Level Classification E-value
Superfamily Cadherin-like 2.22e-31
Family Cadherin 0.0012
Further Details:      
 
Domain Number 2 Region: 574-693
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-27
Family Cadherin 0.0026
Further Details:      
 
Domain Number 3 Region: 468-578
Classification Level Classification E-value
Superfamily Cadherin-like 4.32e-27
Family Cadherin 0.0015
Further Details:      
 
Domain Number 4 Region: 135-246
Classification Level Classification E-value
Superfamily Cadherin-like 5.37e-22
Family Cadherin 0.0027
Further Details:      
 
Domain Number 5 Region: 683-786
Classification Level Classification E-value
Superfamily Cadherin-like 7e-19
Family Cadherin 0.009
Further Details:      
 
Domain Number 6 Region: 355-473
Classification Level Classification E-value
Superfamily Cadherin-like 3.27e-18
Family Cadherin 0.0056
Further Details:      
 
Domain Number 7 Region: 33-133
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000557
Family Cadherin 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013691   Gene: ENSTNIG00000010769   Transcript: ENSTNIT00000013885
Sequence length 1200
Comment pep:known_by_projection chromosome:TETRAODON8:7:7157175:7214137:-1 gene:ENSTNIG00000010769 transcript:ENSTNIT00000013885 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KLQFLFSSLLSVWCMKKNHLFPLLFPSVSADGSVLYRVQEEQPPNTLIGSLAADRGLPDS
GHLYKLEVGSPYLRVEGKTGDIFTTEIPIDRETLRDCRSLIKGKPCYLEFEVSVTDLFQN
QSPRLIEGRIEVQDINDNTPQFPSSVLTISVPENTIMGALFSIPLATDRDSDRNGVADYA
LTTGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSSALL
RVIVTDANDNAPKFEKSMYEAEVSENSPVGHSVLQVKANDSDMGPNGEIEYTLHQAVDPV
PKLLRIDRSSGTIYVKGSLDREDVSSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPA
VEIRGIGLVTHSEGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRSAS
DSSSDNKRKYFLQTTTPLDYERVRTYIVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPIF
SPTLFEVDFAEENQSGERVLDVTASDADSGTNAELLYNILGDSAIKGLFEIDPNTGEVRA
RSPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDRNDNDPKFMLSGYSFSVLENMP
PLSPVGMVTVLDMDKGENAHVHLAVESDGGKFVVQNGTGTILSSISFDREKESSYTFRLK
AVDGGEPPRSSYVGVTINVLDENDNDPVITKPSNSSFRHLSPSAAPESHVEVVEAEDLDS
GPNAELVFNIAGGNPYQLFRISPSSGQITLAKEMTRKHGGLHRLVVRVSDRGKPARHATA
LVHIYVNETISNVSLVEALVGHSLYTPLDRDIAGDPDNGFAAHRSNILFGSLAGVAGVVL
LILVVVFIRHRIQRETKSGYQAGKKETKDLYAPKQAPKNAKGKRGRKGKPQKPPKPLGED
EEVSLQKSLKFNLDGVSDSPRIHLPLTYSPGSPDIGRHYRSNSPLPSIQLQAQSPSASQK
HQVVQDLPAANTFVGTGGDDNSTGSDQYSDYSYKTSQPKYNNKQHPHRRVTFSTANPVQD
LQDASQHSYYDSGLEESETPSSKSSSGPRIGPLTLPEDHYERTTPDGSIGETEHPENDIR
SIPDVAMTGNCTNECSELGHSDACWMPGHPSPVRKTRNPPKLSTFVPYQERGSLGRLANG
SARLGGEEHRSRLPPSRSAYSNSGHDASQDCPLEEMPLSVPSEFPPTSTTVHTPKREIYL
Download sequence
Identical sequences H3CZK5
99883.ENSTNIP00000013691 ENSTNIP00000013691 ENSTNIP00000013691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]