SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013693 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013693
Domain Number 1 Region: 227-352
Classification Level Classification E-value
Superfamily Cadherin-like 9.57e-33
Family Cadherin 0.00076
Further Details:      
 
Domain Number 2 Region: 443-568
Classification Level Classification E-value
Superfamily Cadherin-like 8.85e-32
Family Cadherin 0.0013
Further Details:      
 
Domain Number 3 Region: 124-231
Classification Level Classification E-value
Superfamily Cadherin-like 3.53e-23
Family Cadherin 0.0044
Further Details:      
 
Domain Number 4 Region: 342-447
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-19
Family Cadherin 0.0036
Further Details:      
 
Domain Number 5 Region: 558-663
Classification Level Classification E-value
Superfamily Cadherin-like 4.45e-18
Family Cadherin 0.0041
Further Details:      
 
Domain Number 6 Region: 25-93
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000999
Family Cadherin 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013693   Gene: ENSTNIG00000010770   Transcript: ENSTNIT00000013887
Sequence length 958
Comment pep:known_by_projection chromosome:TETRAODON8:7:7297940:7320126:1 gene:ENSTNIG00000010770 transcript:ENSTNIT00000013887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLSTARTRLAAIFTVIALWRCALSITRYSIPEEMEVGSFVANLATDLTLDVRSLVERRA
KLDVIHSKNYLDINKETGELIIRERIDRENVCMTKTTSCFLKMDVILENPVRIFNIELEI
MDINDNAPVFRRKTMHLDISEATPPGERFSLTNAVDADVGANSIKTYYLSESQYFNIDIQ
TGSDGSKYVDLVLNAQLNREEQAVHHLILTAVDGGVPARSGTASIVINVLDINDNAPVFS
QPVFAVNVSENSAAGTVVLTLNATDLDEGTNAELVYSYTLYTSEKTQEIFTLDPRTGEIR
VKGVIDYEESTSYEMYVQAQDKGPNPLSGHCKVMVFVTDLNDNYPEVTIKSMKSMLTEDV
PVGTLIAVVTVRDRDSGGNGEVALALYQQQSLPFLLNKSSGDYFELMVSKPLDRELVGRY
DITLMVTDKGSPPLAENETIALQILDINDNAPTFSQSIYTIHVVENNQPGALLTSLSAFD
PDLNENGYLVYFIMEKEIANTSMSMLFSINPENGDLYALKTFDYEREKDYLFHIEARDSG
VPPLSSNVTVHIIILDQNDNTPLIVSPWRAQGSVVEEVIPRSTEKGHLIAKVIAIDADSE
QNARVTYQLLQISDTSLFSLDQYNGEIRTTRMFSYRDPRQQRLVIVAKDNGNPALSATMT
IKISTVEHAMSFSETTELPLEYDVFTDLNLYLVIGLGAVSFLLLITILVIIVLKCQKPKP
KAIKLPPANRNSVISRNSVISQRSSTIADSTLISSDAYWYSLFLAETRKGKVVVRQPIIP
KGAGYFVSSIPRSIGPSETTDSRASTLEPKAPNADWRYSASLRAAGVQSSVHMEEASVMQ
GAQGMLVQNWPTVSSAADGEGGGELSPPVGAGVNSNSWNFRYGAAQAYYPPQPLKPGEIP
PEAFIIPGSPAIISIRHDAGPVDDKGEFISFGKKDEAKKKKKKKKDKKDKKEKGKDDE
Download sequence
Identical sequences H3CZK7
ENSTNIP00000013693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]