SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013694 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013694
Domain Number 1 Region: 231-355
Classification Level Classification E-value
Superfamily Cadherin-like 5.42e-28
Family Cadherin 0.001
Further Details:      
 
Domain Number 2 Region: 443-566
Classification Level Classification E-value
Superfamily Cadherin-like 2e-26
Family Cadherin 0.0032
Further Details:      
 
Domain Number 3 Region: 128-235
Classification Level Classification E-value
Superfamily Cadherin-like 1.02e-25
Family Cadherin 0.003
Further Details:      
 
Domain Number 4 Region: 344-447
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-21
Family Cadherin 0.004
Further Details:      
 
Domain Number 5 Region: 558-666
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-19
Family Cadherin 0.0058
Further Details:      
 
Domain Number 6 Region: 31-126
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000012
Family Cadherin 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013694   Gene: ENSTNIG00000010770   Transcript: ENSTNIT00000013888
Sequence length 996
Comment pep:known_by_projection chromosome:TETRAODON8:7:7308946:7320126:1 gene:ENSTNIG00000010770 transcript:ENSTNIT00000013888 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVVGICNWIGNNVPFYFVVFSLFCGLSFGQLRYSITEELENGALVGDLAHDLGLDIRKL
STRKIKVTSNSGKRYVIVNPKDGKLLVNERIDRETLCELSSTCFINLEVLVENPTEVHHV
EVEIVDANDNAPQFLRDEYQLEITESALPGSRYPIEHAQDPDSGSNSVRMYQLSTNDHFA
LVSNKPSINTKHIELVLKKPLDREQTPYHQLILSAVDGGTPEKTGSAKINVRVLDSNDNI
PTFDSSVYKVKLLENSPKDTLVIKLNATDLDEGTNGEVYYSFSSYTPERVRQMFSMDTNT
GEIRVRSNVDYEETNSYEMYIQAMDKGPGAVASHCKVVVEVVDVNDNVPQIVLSSLSSPV
REDARADTVVALISVTDRDSGTNKQVSLEIPPGLPFKIKSFRNYYTLVTSAFLDRETTDA
YNVTLSATDGGNPPLSSQKTIQVDVADVNDNPPRFEQTSYTVYVAENNAHGASLCTVKAQ
DADIKENARITYTVLNDNNHGIPVTSYVSVKADTGEYALRAFDYESLREFHFQVKAQDGG
IPPLSRVATVYIYIMDQNDHPPLIVNPPGNGTRSLETVQKNAEPGVLVTKVVAYDADAGP
NAWLVYVLETATDLDLFKVHEHTGEIRTTRRILEDNFTSFSLTVMVKDHGLPPLSSTATI
NVAVMEVPPKVAPDPKRIIRPHNTLFFSNVTLYLIVALSATTFVFLVTVVVLAIVRCHAY
CSQPGSCSTCCGSQKPPPDGGSSSVSAGGAASGGAGAQPNNNVVLRRDLKVEPHYIEVRG
NGSLTKTYCYKTCLTATSGSDTFMFYNTGRPISGTWGSGADRFFTSGSGFVRRLSMPDAS
LQICPEPKAPNADWRYSASLRAAGVQSSVHMEEASVMQGAQGMLVQNWPTVSSAADGEGG
GELSPPVGAGVNSNSWNFRYGAAQAYYPPQPLKPGEIPPEAFIIPGSPAIISIRHDAGPV
DDKGEFISFGKKDEAKKKKKKKKDKKDKKEKGKDDE
Download sequence
Identical sequences H3CZK8
ENSTNIP00000013694 99883.ENSTNIP00000013694 ENSTNIP00000013694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]