SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013726 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013726
Domain Number 1 Region: 40-228
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.4e-52
Family Astacin 0.00013
Further Details:      
 
Domain Number 2 Region: 397-563
Classification Level Classification E-value
Superfamily TRAF domain-like 1.8e-35
Family MATH domain 0.001
Further Details:      
 
Domain Number 3 Region: 235-399
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.85e-22
Family MAM domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013726   Gene: ENSTNIG00000010801   Transcript: ENSTNIT00000013920
Sequence length 565
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:8800444:8804761:-1 gene:ENSTNIG00000010801 transcript:ENSTNIT00000013920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVDEGHDWDIPNINGVAGVDLLEGDIEQDKTSSRNTIIGEKYRWPTTVPYYLEDSLDMNA
KGVVLKAFDQYRLKTCIDFTPWKGEQNYISVFKGSGCFSSVGNQHVGKQRLSIGKNCDRL
GTVEHEFLHALGLWHEQSRADRDDYVQIMWDQIEPGKEHNFRTRDDTVSSALGVPYDYSS
VMHYSKTSFSRSSEPTIVTKIPHFLDVIGQRMGFSAGDLSKLNRLYKCTKSSTFVESCSF
EEDNICGMIRGSGNRKWERRASVDGGPQTDFTNMGQCKGKGFFMHFSTASAEPADRASLE
TQWLYPKSGVQCLQFFLHRNGASDDVLNIWVREYDKAQGSRRTLFRTITAGGVGGSWELH
AITLNMTQKARVVFEGISGKGPSAGGFSLDDINLSSVKCPEHVWHVRNITGLLATTPAGR
KAYSPRFLSSTGYSFQVGVYLNGVSSRPGYMAVYLHLTSGPNDHKLRWPCPWHQGTMALL
DQQSDIRQQMSMHRMVTTDPKMISSDGTEFYWDDPRKVGSKITASDGSFYYRGPGYGTST
FIAHSRLRSRNFLKGDDAFFLLSFE
Download sequence
Identical sequences H3CZP0
ENSTNIP00000013726 ENSTNIP00000013726 99883.ENSTNIP00000013726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]