SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013746 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013746
Domain Number 1 Region: 26-217
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.18e-42
Family Astacin 0.00063
Further Details:      
 
Domain Number 2 Region: 339-441
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.15e-38
Family Spermadhesin, CUB domain 0.00029
Further Details:      
 
Domain Number 3 Region: 643-755
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-37
Family Spermadhesin, CUB domain 0.00021
Further Details:      
 
Domain Number 4 Region: 488-598
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.85e-36
Family Spermadhesin, CUB domain 0.00041
Further Details:      
 
Domain Number 5 Region: 220-327
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.22e-28
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 6 Region: 787-868
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.67e-22
Family Spermadhesin, CUB domain 0.00086
Further Details:      
 
Domain Number 7 Region: 597-640
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000112
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 8 Region: 443-486
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000043
Family EGF-type module 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013746   Gene: ENSTNIG00000010819   Transcript: ENSTNIT00000013940
Sequence length 879
Comment pep:known_by_projection chromosome:TETRAODON8:12:641087:654918:1 gene:ENSTNIG00000010819 transcript:ENSTNIT00000013940 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSAASTGQISQNRHGSHRRKRAATSRPERVWPEGVIPYVISGNFSGMCVYGNSAIREMLR
NLKIWGCLFFILFFVFIFLKMKCCSYVGRRGGGPQAISIGKNCDKFGIVVHELGHVIGFW
HEHTRPDRDEHVSIIRENIQPGQEYNFLKMEPGEVDSLGEVYDFDSIMHYARNTFSRGIF
LDTILPRYDVNGVRPPIGQRTRLSKGDIAQARKLYKCSRCGDSLQDSSGNFSSPGFPNGY
SAYMHCIWRISVTPGEKVRTNKKLYRSHLCWYDHVEIRDGWRKAPLKDRFCGDKLPEPII
STDSRLWIEFRSSSNWVGKGFSAVYEAHAAICGGEVKKDNGQIQSPNYPDDYRPNKMCVW
KITVAQGYHVGLTFQSFEIERHDSCAYDYLEVRDGNNENSPLLGRFCGYDKPDDIKTSSN
QLWMKFVSDGSVNKAGFAANFFKEMDECSKPDNGRCEQRCVNTLGSYKCACDPGYELAAD
KRSCEAACGGFITKLNGSITSPGWPREYPPNKNCIWQLVAPTQYRITLLFDVFETEGNDV
CKYDYVEVRSGLSADSKLHGKFCGAEKPETITSQYNNMRIEFKSDNTVSKKGFKAQFFSD
KDECSKENGGCQHECVNTFGSYSCQCRSGFVLHENKHDCKEAGCDHTVNSVSGTITSPNW
PDKYPSKKACTWALTTTPGHRIKISFNEIDIEAHLECTYDRIELYDGKDGKASLLGRFCG
TKKPPPVTSSGNKLFIRFFSDNSVQKKGFEASHTAECGGHLKAEVKTKDLFSHAQFGDNN
YPGGSELSTEKGYGVELIFQTFEIEEEADCGYDYMELFDGADTKSPRLGRYCGSGPPEEI
YSAGDSIVIKFRSDDTINKKGFHVRFTSTKFQDTLHSRK
Download sequence
Identical sequences H3CZR0
99883.ENSTNIP00000013746 ENSTNIP00000013746 ENSTNIP00000013746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]