SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013760 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013760
Domain Number 1 Region: 128-218
Classification Level Classification E-value
Superfamily Fibronectin type III 2.49e-17
Family Fibronectin type III 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000013760
Domain Number - Region: 3-63
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00459
Family Ankyrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013760   Gene: ENSTNIG00000010831   Transcript: ENSTNIT00000013954
Sequence length 632
Comment pep:novel chromosome:TETRAODON8:Un_random:5698073:5704372:-1 gene:ENSTNIG00000010831 transcript:ENSTNIT00000013954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSLWEAVENEDTLAVQSLLSKDHIKEKGVNRVSDQGLVPLDVAALTHNSPLLHVLSKAGA
RPNPVLCQPAEWAFKLDALVALAGKRVEEKKMESLRKPGPSADLSRQVRLWSLRLQLYCR
MRENFHKTELPGPPSHVSILVTSTSSLFVSIKEPEGDTMGLITRYRVEWSTSESFKRILG
SVQVTETKNPSYTIKGLTTGVYYFVRVSAFNVKGWGPPRCSTPASAATSSWRECVGVKSQ
FRNNEGLLRKLLEDAREPDYKGICFESTKPQSPSKRLSVSRGIKQLFQSATKFVRLLQRG
VYLATVFYHKDNILVTAEDQIPLVEIQCCSTSISQDFFWFAKLSCVWQQVPWLQQALASA
QSSSSSLLQNRHNILKAVSLLQTSLGTMDLGQVYYEPLKDRQGNILLVTLKDYLDITLSS
PDPPFHWMPLARLERNRTRTPLLPEPTAMDTLYEQLKEKISFHRRSTQWAQPGLYVGILK
LCSSVEQIRVLVPQRLPNLLCHTRVRVNAHVSREEWAWLQSHVYTSTGSAQNLLGSEDEC
LTETGALTEFARSLRAAVTHLLTKLNIPLYRAYQYGVYTRELLQFGDKASMLLLLPPSED
FSSSYWPLVGTKEPGLTMPLQIFELGIMFCFS
Download sequence
Identical sequences H3CZS4
ENSTNIP00000013760 99883.ENSTNIP00000013760 ENSTNIP00000013760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]